BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I24 (924 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 23 4.4 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 5.9 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 22.6 bits (46), Expect = 4.4 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 388 RXALGDANGKAKEALEQSRQNIERTXEELRKAHPDVEKNATXLREKLQ 531 R LGD + K + Q+ + +ER +E + +P V + L E ++ Sbjct: 27 RDVLGDIHAKPTYSDLQNLKYLERCIKESLRLYPSVHLISRALGEDVR 74 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 206 RRDAPDFFKDIEH 244 RR AP F+DI+H Sbjct: 84 RRKAPQSFEDIQH 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,776 Number of Sequences: 336 Number of extensions: 1467 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25858250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -