SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP04_F_I24
         (924 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF264721-1|AAF75273.1|  126|Tribolium castaneum putative cytochr...    23   4.4  
AJ829922-1|CAH25640.1|  193|Tribolium castaneum twist bHLH trans...    22   5.9  

>AF264721-1|AAF75273.1|  126|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q2 protein.
          Length = 126

 Score = 22.6 bits (46), Expect = 4.4
 Identities = 13/48 (27%), Positives = 24/48 (50%)
 Frame = +1

Query: 388 RXALGDANGKAKEALEQSRQNIERTXEELRKAHPDVEKNATXLREKLQ 531
           R  LGD + K   +  Q+ + +ER  +E  + +P V   +  L E ++
Sbjct: 27  RDVLGDIHAKPTYSDLQNLKYLERCIKESLRLYPSVHLISRALGEDVR 74


>AJ829922-1|CAH25640.1|  193|Tribolium castaneum twist bHLH
           transcription factor protein.
          Length = 193

 Score = 22.2 bits (45), Expect = 5.9
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +2

Query: 206 RRDAPDFFKDIEH 244
           RR AP  F+DI+H
Sbjct: 84  RRKAPQSFEDIQH 96


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,776
Number of Sequences: 336
Number of extensions: 1467
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25858250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -