BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I24 (924 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.19 |||histone acetyltransferase complex subunit Eaf7 |S... 29 1.2 SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 29 1.2 SPCC188.04c |spc25||kinetochore protein Spc25|Schizosaccharomyce... 28 1.6 SPBC29A10.13 |atp7||F0-ATPase subunit D|Schizosaccharomyces pomb... 26 6.5 SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomy... 26 8.6 SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Sch... 26 8.6 >SPBC16A3.19 |||histone acetyltransferase complex subunit Eaf7 |Schizosaccharomyces pombe|chr 2|||Manual Length = 272 Score = 28.7 bits (61), Expect = 1.2 Identities = 17/69 (24%), Positives = 38/69 (55%) Frame = +1 Query: 415 KAKEALEQSRQNIERTXEELRKAHPDVEKNATXLREKLQAXVQNTVQESQKLAKKVSSNV 594 K+++ LE S Q +E E + P+V++ +EK ++ V+ +E +K+S N+ Sbjct: 132 KSEKPLETS-QKVEIETVETKPGEPEVKQETNLQKEKKESKVKLESKE-----EKISRNL 185 Query: 595 QETNEKLAP 621 + ++ ++P Sbjct: 186 RSSSRSISP 194 >SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 419 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/65 (21%), Positives = 30/65 (46%) Frame = +1 Query: 415 KAKEALEQSRQNIERTXEELRKAHPDVEKNATXLREKLQAXVQNTVQESQKLAKKVSSNV 594 KA + LE+ ++ E + EE+ H + T + + + +QE ++ K + Sbjct: 353 KACKDLEEVSKSYEESREEIEALHETFTEEVTSFQSTKRLKEEKIIQEKSRVDKMIDEYR 412 Query: 595 QETNE 609 Q+ +E Sbjct: 413 QKLSE 417 >SPCC188.04c |spc25||kinetochore protein Spc25|Schizosaccharomyces pombe|chr 3|||Manual Length = 238 Score = 28.3 bits (60), Expect = 1.6 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +1 Query: 397 LGDANGKAKEALEQSRQNIERTXEELRKAHPD---VEKNATXLREKLQAXVQNTVQESQK 567 + +A KA+++LEQ+ + E L K H + E+ +EKL A ++ + S++ Sbjct: 52 INEAQKKAEKSLEQTEARKQNFTELLEKEHEEQAITEQEIFSFQEKLDAMLKRKQKLSEE 111 Query: 568 L 570 L Sbjct: 112 L 112 >SPBC29A10.13 |atp7||F0-ATPase subunit D|Schizosaccharomyces pombe|chr 2|||Manual Length = 175 Score = 26.2 bits (55), Expect = 6.5 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 430 LEQSRQNIERTXEELRKAHPDVEK 501 +EQ+R E T E++++A P++EK Sbjct: 126 IEQARPTEEITIEDMKQAVPEIEK 149 >SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1115 Score = 25.8 bits (54), Expect = 8.6 Identities = 15/67 (22%), Positives = 34/67 (50%) Frame = +1 Query: 430 LEQSRQNIERTXEELRKAHPDVEKNATXLREKLQAXVQNTVQESQKLAKKVSSNVQETNE 609 ++ Q+IE T L K D+E++ +++ + V + Q+ ++++ +Q+T E Sbjct: 496 MKTQEQSIELT--RLYKQLQDIEEDYENKLMRMEQQWREDVDQLQEYVEEITQELQDTKE 553 Query: 610 KLAPKIK 630 L+ K Sbjct: 554 VLSKSSK 560 >SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1108 Score = 25.8 bits (54), Expect = 8.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 409 NGKAKEALEQSRQNIERTXEELRKAHPDVEKN 504 N K KE E++ + EELR+A PD E++ Sbjct: 22 NEKLKEDFEENVSIDVKIHEELRRALPDYEES 53 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,799,463 Number of Sequences: 5004 Number of extensions: 23638 Number of successful extensions: 98 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 467341524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -