BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I23 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 5.4 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 9.4 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 469 ISAHQTFLTPSLFYIFV*HVFFLRTPIHIDFIKLSCSYI 585 +S QT + + F+ HV + +D I CSY+ Sbjct: 131 LSKIQTLKLAARYIDFLYHVLSNENALDVDLIGNVCSYV 169 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 353 FDDLDVGFLGIILRSAGQFVPSVKFGF 273 FD FLGI+ F+ ++FGF Sbjct: 329 FDISRSTFLGILATITTYFIVIIEFGF 355 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,243 Number of Sequences: 336 Number of extensions: 2962 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -