BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I20 (929 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1177 + 35147036-35147038,35147128-35147220,35147322-351474... 135 5e-32 >01_06_1177 + 35147036-35147038,35147128-35147220,35147322-35147406, 35147588-35147760 Length = 117 Score = 135 bits (326), Expect = 5e-32 Identities = 59/99 (59%), Positives = 79/99 (79%) Frame = +3 Query: 132 KHGRGHVKAVXCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKLYAKL 311 KHGRGHVK + C+NCA+C PKDKAIK+F +RNIVE AA+RD+ +A V+ + LPKLYAK+ Sbjct: 12 KHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDGYVLPKLYAKV 71 Query: 312 HYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQ 428 H+CVSCAIH+ +VR RS+++RR R PP+ F R + P+ Sbjct: 72 HHCVSCAIHAHIVRVRSRENRRDRRPPE-RFRRRVPDPR 109 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,892,751 Number of Sequences: 37544 Number of extensions: 224016 Number of successful extensions: 457 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2659245980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -