BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I20 (929 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 168 5e-42 SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.062 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 168 bits (409), Expect = 5e-42 Identities = 76/88 (86%), Positives = 82/88 (93%) Frame = +3 Query: 129 AKHGRGHVKAVXCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKLYAK 308 +KHGRGHVK V CTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY ++ LPKLY K Sbjct: 11 SKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYEVYALPKLYVK 70 Query: 309 LHYCVSCAIHSKVVRNRSKKDRRIRTPP 392 LHYCVSCAIHSKVVRNRSK+DR+IRTPP Sbjct: 71 LHYCVSCAIHSKVVRNRSKEDRKIRTPP 98 >SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 35.5 bits (78), Expect = 0.062 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 7/77 (9%) Frame = +3 Query: 174 CAR-CVPKDKAIKKFVIRNIVEAAAVRD--INDASVYPMFQLPKLYAKLHYC--VS--CA 332 C R C+ +D+ I FVI AAAVRD + D ++Y + C VS C Sbjct: 664 CERDCIMRDRTICDFVICG--RAAAVRDCIMRDRAIYNCVMSDRFIRDCVMCDRVSRDCL 721 Query: 333 IHSKVVRNRSKKDRRIR 383 IH +VVR+ +DR IR Sbjct: 722 IHDRVVRDCVMRDRVIR 738 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,696,496 Number of Sequences: 59808 Number of extensions: 246478 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2705204627 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -