BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I14 (874 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-30 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 68 9e-12 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 64 1e-10 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 63 2e-10 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 60 2e-09 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 59 5e-09 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 57 2e-08 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 56 3e-08 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 56 3e-08 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 55 9e-08 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 54 1e-07 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 50 2e-06 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 48 1e-05 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 45 7e-05 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 42 5e-04 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 39 0.006 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.100 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 34 0.17 SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) 31 1.2 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 31 1.2 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 31 1.6 SB_35625| Best HMM Match : DUF296 (HMM E-Value=0.0053) 28 8.7 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 97.9 bits (233), Expect(2) = 3e-30 Identities = 49/108 (45%), Positives = 66/108 (61%) Frame = +3 Query: 261 MGLLDLCEKYFNSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFK 440 M LD ++ F NLY+VL + +TASE E+K+AY K+SL+V PDR + +K +AT KF+ Sbjct: 1 MPFLDELDRLFGVKNLYDVLGVSKTASESEIKRAYRKISLQVHPDRADKGEKEKATRKFQ 60 Query: 441 VLGSIHEILSDKNKRAVYDETKSXXXXXXXXXXXXXWTVYWRHLFKKI 584 L + ILSDK KRA+YDE S WT YWR L K++ Sbjct: 61 ALSKSYCILSDKEKRAIYDE--SGEIDEENIDEDRDWTQYWRLLSKRL 106 Score = 52.4 bits (120), Expect(2) = 3e-30 Identities = 27/64 (42%), Positives = 35/64 (54%) Frame = +3 Query: 576 KKITEXDIXAYEKEYTGSQEEKDDLKXAYLTGKGDMDYITDHVQFAXTEHEPRIREXLNK 755 KK+T DI +E Y GS EE DL AY KGDMD I +++ + E R E L Sbjct: 133 KKVTLEDIRKFEASYKGSDEELSDLMSAYEDYKGDMDQIMENMLCSNDSDEDRFAEILQG 192 Query: 756 MIKD 767 +IK+ Sbjct: 193 LIKE 196 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 68.1 bits (159), Expect = 9e-12 Identities = 32/68 (47%), Positives = 47/68 (69%) Frame = +3 Query: 297 SSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDK 476 S + YEVL +P +ASE++VKKAY + +L+ PD+ + + A EKFK L +E+LSDK Sbjct: 2 SEDYYEVLGVPRSASEEDVKKAYRRQALRWHPDK-NPTNREHAEEKFKKLSEAYEVLSDK 60 Query: 477 NKRAVYDE 500 KR +YD+ Sbjct: 61 EKRDIYDK 68 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 64.1 bits (149), Expect = 1e-10 Identities = 26/66 (39%), Positives = 47/66 (71%) Frame = +3 Query: 303 NLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNK 482 + Y +L +P AS+ ++K+AY KL++K+ PD+ +D K A EKF +G+ +E+L+D ++ Sbjct: 25 DFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPK--AQEKFHDIGAAYEVLADDDQ 82 Query: 483 RAVYDE 500 R +YD+ Sbjct: 83 RKIYDQ 88 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 63.3 bits (147), Expect = 2e-10 Identities = 26/68 (38%), Positives = 48/68 (70%) Frame = +3 Query: 297 SSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDK 476 + + Y++L +P AS+K++KKA+ K+++K PD+ ++ +A EKF+ + +E+LSD+ Sbjct: 24 AKDYYQILGVPRNASDKQIKKAFRKMAVKYHPDK---NKGKDAEEKFREVAEAYEVLSDE 80 Query: 477 NKRAVYDE 500 NKR YD+ Sbjct: 81 NKRRQYDQ 88 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/77 (38%), Positives = 50/77 (64%) Frame = +3 Query: 267 LLDLCEKYFNSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVL 446 L D+ E+ N Y+VL + TA++ E+++AY ++SL++ PDR ED +A KF+ L Sbjct: 2473 LFDIVEEV--KDNFYQVLGVETTATQAEIRRAYRRISLQLHPDRNKED---DAELKFRKL 2527 Query: 447 GSIHEILSDKNKRAVYD 497 ++ E+L D++KR YD Sbjct: 2528 VAVAEVLKDEDKRKRYD 2544 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 59.7 bits (138), Expect = 3e-09 Identities = 26/64 (40%), Positives = 43/64 (67%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNKRA 488 Y++L +P TA+ E+KK+Y KL+LK PD+ ++ ++FK + +E+LSD+ KR Sbjct: 67 YDILNVPPTATATEIKKSYRKLALKYHPDKNPDE-----GDRFKQISQAYEVLSDEKKRK 121 Query: 489 VYDE 500 +YDE Sbjct: 122 IYDE 125 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 58.8 bits (136), Expect = 5e-09 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDR---VSEDQKLEATEKFKVLGSIHEILSDKN 479 Y++L I +TASE E+KKAY K +LK PDR S++QK A ++FK + + ILSD Sbjct: 161 YKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPK 220 Query: 480 KRAVYD 497 K+ YD Sbjct: 221 KKRRYD 226 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 58.8 bits (136), Expect = 5e-09 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDR---VSEDQKLEATEKFKVLGSIHEILSDKN 479 Y++L I +TASE E+KKAY K +LK PDR S++QK A ++FK + + ILSD Sbjct: 161 YKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPK 220 Query: 480 KRAVYD 497 K+ YD Sbjct: 221 KKRRYD 226 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 57.6 bits (133), Expect = 1e-08 Identities = 27/63 (42%), Positives = 43/63 (68%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNKRA 488 Y++L +P A++KE+KKAY +L+ K PD ++D+ A+EKF+ + +E+LSD KR Sbjct: 61 YKILGVPPNANQKEIKKAYFELAKKYHPD-TNKDK--SASEKFQEVSEAYEVLSDDGKRK 117 Query: 489 VYD 497 YD Sbjct: 118 AYD 120 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 57.2 bits (132), Expect = 2e-08 Identities = 27/66 (40%), Positives = 44/66 (66%) Frame = +3 Query: 303 NLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNK 482 N Y++L + + AS++E+KKAY K + K PD+ ++D E EKFK + +E+LSD K Sbjct: 4 NYYDILGVKKDASDQELKKAYKKQAFKYHPDK-NKDPGAE--EKFKEIAEAYEVLSDPQK 60 Query: 483 RAVYDE 500 R ++D+ Sbjct: 61 REIFDQ 66 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 57.2 bits (132), Expect = 2e-08 Identities = 25/58 (43%), Positives = 41/58 (70%) Frame = +3 Query: 300 SNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSD 473 ++ Y++L +P +ASE+++KK+Y KL+LK PD+ + K EA KFK + +E+LSD Sbjct: 2 ADYYDILEVPRSASEQDIKKSYRKLALKWHPDK-NPQNKEEAERKFKEISEAYEVLSD 58 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/66 (40%), Positives = 43/66 (65%) Frame = +3 Query: 300 SNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKN 479 + LY++L +P+ AS+ ++KKAY KL+ ++ PD+ + EKFK + +EILSD Sbjct: 4 TRLYDLLGVPQNASDNDIKKAYRKLAKELHPDK-----NPDTGEKFKDITFAYEILSDPE 58 Query: 480 KRAVYD 497 KR +YD Sbjct: 59 KRELYD 64 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/66 (40%), Positives = 43/66 (65%) Frame = +3 Query: 300 SNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKN 479 + LY++L +P+ AS+ ++KKAY KL+ ++ PD+ + EKFK + +EILSD Sbjct: 4 TRLYDLLGVPQNASDNDIKKAYRKLAKELHPDK-----NPDTGEKFKDITFAYEILSDPE 58 Query: 480 KRAVYD 497 KR +YD Sbjct: 59 KRELYD 64 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 54.8 bits (126), Expect = 9e-08 Identities = 26/64 (40%), Positives = 40/64 (62%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNKRA 488 Y VL + + AS ++KKAY K +LK PD+ ++ A EKFK + +E+LSD K+ Sbjct: 6 YAVLNVDKAASADDIKKAYRKQALKYHPDK---NKSPGAEEKFKEISEAYEVLSDPKKKE 62 Query: 489 VYDE 500 +YD+ Sbjct: 63 IYDQ 66 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/64 (37%), Positives = 42/64 (65%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNKRA 488 Y++L + +A++ ++KK Y KLSLK PD+ +Q+ A KF+ +++LSD KRA Sbjct: 6 YDILGLTRSATDADIKKEYRKLSLKYHPDK---NQEPSAEVKFRQAAEAYDVLSDPKKRA 62 Query: 489 VYDE 500 +Y++ Sbjct: 63 IYNQ 66 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/71 (32%), Positives = 40/71 (56%) Frame = +3 Query: 285 KYFNSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEI 464 K + Y++L + +++E+ KAY KL++K PD + K +A + F + + E+ Sbjct: 202 KQSQKRDYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEV 261 Query: 465 LSDKNKRAVYD 497 L+D KRA YD Sbjct: 262 LTDPEKRAKYD 272 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = +3 Query: 303 NLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSD-KN 479 N Y VL + E A+++E+KK Y KL++K PDR D K EA + F + +EILS K Sbjct: 794 NSYRVLGLTEDATQEEIKKRYKKLAMKWHPDR-HRDNKEEAQKHFMEIQEAYEILSKLKT 852 Query: 480 KRA 488 KRA Sbjct: 853 KRA 855 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/65 (33%), Positives = 40/65 (61%) Frame = +3 Query: 303 NLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNK 482 N Y +L +P AS+ ++KKAY + +L PD+ ++ A EKFK + +++L+D + Sbjct: 4 NYYAILGVPRNASDDDIKKAYRRQALIFHPDK---NKNSGAEEKFKEISEAYKVLTDPRQ 60 Query: 483 RAVYD 497 R ++D Sbjct: 61 RDIFD 65 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/64 (37%), Positives = 38/64 (59%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNKRA 488 YEVL + + +KK Y KL+LK PD+ + D E+T F+ + +++LSD +RA Sbjct: 6 YEVLGVERDVDDSALKKTYRKLALKWHPDK-NLDNAEESTRVFREIQQAYDVLSDPQERA 64 Query: 489 VYDE 500 YD+ Sbjct: 65 FYDK 68 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/65 (36%), Positives = 39/65 (60%) Frame = +3 Query: 303 NLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNK 482 N Y+ L + + ++EKE+ KAY K +LK PD+ ++ K A+E F L E+L+D Sbjct: 7 NYYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPK--ASELFHKLSKALEVLTDPKA 64 Query: 483 RAVYD 497 RA ++ Sbjct: 65 RAAFN 69 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/67 (32%), Positives = 39/67 (58%) Frame = +3 Query: 300 SNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKN 479 SN YEVL + A+ ++++AY +L+LK PD+ + + E FK + +E+L D Sbjct: 3 SNYYEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTE-----ENFKEVSEAYEVLCDPQ 57 Query: 480 KRAVYDE 500 +R +D+ Sbjct: 58 QRERFDK 64 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/68 (33%), Positives = 35/68 (51%) Frame = +3 Query: 294 NSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSD 473 + N Y VL + AS+ ++K AY+KLS+K PDR K E F+ + + +L + Sbjct: 69 SKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKH--EVFQEIAEAYSVLGN 126 Query: 474 KNKRAVYD 497 R YD Sbjct: 127 LESRKQYD 134 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/68 (33%), Positives = 35/68 (51%) Frame = +3 Query: 294 NSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSD 473 + N Y VL + AS+ ++K AY+KLS+K PDR K E F+ + + +L + Sbjct: 69 SKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKH--EVFQEIAEAYSVLGN 126 Query: 474 KNKRAVYD 497 R YD Sbjct: 127 LESRKQYD 134 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/69 (34%), Positives = 37/69 (53%) Frame = +3 Query: 294 NSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSD 473 N N Y+V+ + TA+++E+K AY++LS PD + EA E+F L + LS Sbjct: 48 NPKNHYDVMKLLPTATQREIKSAYYELSRIYHPDL---NSSAEARERFAELTLAYNTLSR 104 Query: 474 KNKRAVYDE 500 R YD+ Sbjct: 105 LETRREYDK 113 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/69 (34%), Positives = 37/69 (53%) Frame = +3 Query: 294 NSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSD 473 N N Y+V+ + TA+++E+K AY++LS PD + EA E+F L + LS Sbjct: 195 NPKNHYDVMKLLPTATQREIKSAYYELSRIYHPDL---NSSAEARERFAELTLAYNTLSR 251 Query: 474 KNKRAVYDE 500 R YD+ Sbjct: 252 LETRREYDK 260 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/65 (30%), Positives = 35/65 (53%) Frame = +3 Query: 303 NLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNK 482 N YE+L +P+ AS+ E+K A+ K + + PD +D ++ + F + + LS + Sbjct: 8 NFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDP--DSHKAFIKVSEAYTTLSSSAR 65 Query: 483 RAVYD 497 R YD Sbjct: 66 RQQYD 70 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/65 (30%), Positives = 35/65 (53%) Frame = +3 Query: 303 NLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGSIHEILSDKNK 482 N YE+L +P+ AS+ E+K A+ K + + PD +D ++ + F + + LS + Sbjct: 69 NFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDP--DSHKAFIKVSEAYTTLSSSAR 126 Query: 483 RAVYD 497 R YD Sbjct: 127 RQQYD 131 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 34.7 bits (76), Expect = 0.100 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDR 398 YE+ I A+ KE++KA+ KL+L++ PD+ Sbjct: 30 YELFGISRDATSKEIRKAFKKLALRLHPDK 59 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/62 (29%), Positives = 36/62 (58%) Frame = +3 Query: 273 DLCEKYFNSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGS 452 ++ ++ N+ + YE L I + A++ ++ +AY KL++ + PD+ EA FK L S Sbjct: 133 EVIQRLKNAKDHYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEA---FKALSS 189 Query: 453 IH 458 ++ Sbjct: 190 LN 191 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 33.9 bits (74), Expect = 0.17 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDR 398 Y +L +P AS+ ++K+ Y KL++ + PD+ Sbjct: 802 YSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) Length = 595 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 818 FFLXGSWVNILYAGIXXIFYHFIEXFPDSRFMFSXSKL--NMICNV 687 FF+ GSW+ + G+ + F+ F +F ++L N+ CN+ Sbjct: 488 FFVMGSWIPVTLLGLSSLINPFLYAFRHQKFQREATRLGRNISCNI 533 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +3 Query: 315 VLXIPETASEKEVKKAYHKLSLKVXPDR 398 +L +P AS+ ++K+ Y KL++ + PD+ Sbjct: 2 ILGVPPEASDDDIKRQYRKLAVLIHPDK 29 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +3 Query: 309 YEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKF 437 Y+V+ + TA+ +E+K AY++LS PD + EA E+F Sbjct: 77 YDVMKLLPTATLREIKSAYYELSRIYHPDL---NSSAEARERF 116 >SB_35625| Best HMM Match : DUF296 (HMM E-Value=0.0053) Length = 885 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/61 (22%), Positives = 26/61 (42%) Frame = +3 Query: 273 DLCEKYFNSSNLYEVLXIPETASEKEVKKAYHKLSLKVXPDRVSEDQKLEATEKFKVLGS 452 ++C KYF PE E EV ++ + +L + R+S + + F + G Sbjct: 98 EVCRKYFEGLGSTPTKSKPEVEIEPEVAPSFAETNLPLLQSRLSISARFLSKSHFSMRGG 157 Query: 453 I 455 + Sbjct: 158 V 158 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,977,300 Number of Sequences: 59808 Number of extensions: 209764 Number of successful extensions: 550 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -