BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I09 (853 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|c... 27 2.6 SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces... 27 4.5 SPAPB2B4.03 |cig2|cyc17|cyclin Cig2|Schizosaccharomyces pombe|ch... 26 7.8 >SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 27.5 bits (58), Expect = 2.6 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = +3 Query: 489 RLYNNLXPNSPLRYHVYYHVIELAARV 569 RLY+ + + +R++V Y+V+E+A R+ Sbjct: 246 RLYHIIRAQASIRFYVLYNVLEIADRL 272 >SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 567 Score = 26.6 bits (56), Expect = 4.5 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 141 QVEKGIKMQGPAVFMDISLEDQALELRRYFKSLGAEISEEKSPKGIEDD 287 ++ +GIK +G ++ +I+ +DQA YF S E E + E D Sbjct: 461 RISEGIKEEGISLSEEITDKDQAFASMGYFDSYNFEGVENSNSLNNEGD 509 >SPAPB2B4.03 |cig2|cyc17|cyclin Cig2|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.8 bits (54), Expect = 7.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 188 VHKHSWPLHFNSFFDLYSFIYYLKA 114 +H H+ PL +FF YS +LKA Sbjct: 352 LHYHNKPLEHKAFFQKYSSKRFLKA 376 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,739,549 Number of Sequences: 5004 Number of extensions: 48517 Number of successful extensions: 116 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -