BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_I07 (878 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XC... 47 2e-05 At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XC... 47 2e-05 At2g27420.1 68415.m03314 cysteine proteinase, putative contains ... 45 8e-05 At1g29110.1 68414.m03563 cysteine proteinase, putative contains ... 45 8e-05 At4g23520.1 68417.m03390 cysteine proteinase, putative contains ... 44 1e-04 At2g34080.1 68415.m04172 cysteine proteinase, putative contains ... 44 1e-04 At1g29090.1 68414.m03561 peptidase C1A papain family protein con... 44 2e-04 At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XC... 42 5e-04 At5g60360.1 68418.m07568 cysteine proteinase, putative / AALP pr... 40 0.002 At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol pro... 39 0.005 At3g43960.1 68416.m04706 cysteine proteinase, putative contains ... 38 0.009 At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p... 37 0.020 At4g11320.1 68417.m01828 cysteine proteinase, putative contains ... 36 0.036 At3g45310.1 68416.m04892 cysteine proteinase, putative similar t... 36 0.036 At4g16190.1 68417.m02457 cysteine proteinase, putative contains ... 36 0.047 At1g29080.1 68414.m03560 peptidase C1A papain family protein con... 34 0.14 At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG1... 33 0.25 At3g48340.1 68416.m05276 cysteine proteinase, putative similar t... 31 1.3 At5g66210.2 68418.m08341 calcium-dependent protein kinase family... 30 1.8 At5g66210.1 68418.m08340 calcium-dependent protein kinase family... 30 1.8 At5g50260.1 68418.m06224 cysteine proteinase, putative similar t... 30 2.3 At2g38120.1 68415.m04679 amino acid permease, putative (AUX1) id... 29 5.4 At3g60290.1 68416.m06739 oxidoreductase, 2OG-Fe(II) oxygenase fa... 28 7.2 At3g48350.1 68416.m05277 cysteine proteinase, putative similar t... 28 9.5 >At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 288 Score = 46.8 bits (106), Expect = 2e-05 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%) Frame = +3 Query: 135 ALLIATVVMASSAEPXXPSHYA-LNQAKXLFEIFVKXHNREYKDDADRELHYQSFKKHLA 311 ALL S P H ++ LFE ++ H++ YK ++ ++ F+++L Sbjct: 21 ALLCCAFARDFSIVGYTPEHLTNTDKLLELFESWMSEHSKAYKSVEEKVHRFEVFRENLM 80 Query: 312 EINQLNEKNPYTTFGINKFADYTPEEQQSR-LGLRLP 419 I+Q N + G+N+FAD T EE + R LGL P Sbjct: 81 HIDQRNNEINSYWLGLNEFADLTHEEFKGRYLGLAKP 117 >At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 355 Score = 46.8 bits (106), Expect = 2e-05 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%) Frame = +3 Query: 135 ALLIATVVMASSAEPXXPSHYA-LNQAKXLFEIFVKXHNREYKDDADRELHYQSFKKHLA 311 ALL S P H ++ LFE ++ H++ YK ++ ++ F+++L Sbjct: 21 ALLCCAFARDFSIVGYTPEHLTNTDKLLELFESWMSEHSKAYKSVEEKVHRFEVFRENLM 80 Query: 312 EINQLNEKNPYTTFGINKFADYTPEEQQSR-LGLRLP 419 I+Q N + G+N+FAD T EE + R LGL P Sbjct: 81 HIDQRNNEINSYWLGLNEFADLTHEEFKGRYLGLAKP 117 >At2g27420.1 68415.m03314 cysteine proteinase, putative contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas] Length = 348 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 2/84 (2%) Frame = +3 Query: 225 EIFVKXHNREYKDDADRELHYQSFKKHLAEINQLNEKNPYT-TFGINKFADYTPEE-QQS 398 E ++ NR Y D+ ++ + FKK+L + N N T IN+F+D T EE + + Sbjct: 36 EQWMARFNRVYSDETEKRNRFNIFKKNLEFVQNFNMNNKITYKVDINEFSDLTDEEFRAT 95 Query: 399 RLGLRLPAKKT*VLRLQXYRNAIP 470 GL +P T + L +N +P Sbjct: 96 HTGLVVPEAITRISTLSSGKNTVP 119 >At1g29110.1 68414.m03563 cysteine proteinase, putative contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas] Length = 334 Score = 44.8 bits (101), Expect = 8e-05 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 5/102 (4%) Frame = +3 Query: 126 VSVALLIATV-VMASSAEPXXPSHYALNQAKXL--FEIFVKXHNREYKDDADRELHYQSF 296 V VAL I ++ + S A P H LN+ + + ++ +R YKD++++E+ + F Sbjct: 7 VFVALTILSMDLRISQARP----HVTLNEQSIVDYHQQWMTQFSRVYKDESEKEMRLKVF 62 Query: 297 KKHLAEINQLNEK-NPYTTFGINKFADYTPEE-QQSRLGLRL 416 KK+L I N N T G+N+F D+ EE + GLR+ Sbjct: 63 KKNLKFIENFNNMGNQSYTLGVNEFTDWKTEEFLATHTGLRV 104 >At4g23520.1 68417.m03390 cysteine proteinase, putative contains similarity to cysteine proteinase (thiol protease) RD21A GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 356 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 6/90 (6%) Frame = +3 Query: 138 LLIATVVMASSAEPXXPS----HYALNQ-AKXLFEIFVKXHNREYKDD-ADRELHYQSFK 299 LLI V+ A S+ P+ H N+ + +F++++ H + Y + ++E +Q+FK Sbjct: 14 LLIVFVLSAPSSAMDLPATSGGHNRSNEEVEFIFQMWMSKHGKTYTNALGEKERRFQNFK 73 Query: 300 KHLAEINQLNEKNPYTTFGINKFADYTPEE 389 +L I+Q N KN G+ +FAD T +E Sbjct: 74 DNLRFIDQHNAKNLSYQLGLTRFADLTVQE 103 >At2g34080.1 68415.m04172 cysteine proteinase, putative contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas] Length = 345 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +3 Query: 225 EIFVKXHNREYKDDADRELHYQSFKKHLAEINQLNEK-NPYTTFGINKFADYTPEE 389 E ++ +REY+D+ ++ + FKK+L I N+K N G+N+FAD+T EE Sbjct: 40 EQWMARFSREYRDELEKNMRRDVFKKNLKFIENFNKKGNKSYKLGVNEFADWTNEE 95 >At1g29090.1 68414.m03561 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 355 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/49 (38%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +3 Query: 246 NREYKDDADRELHYQSFKKHLAEINQLNEKNPYT-TFGINKFADYTPEE 389 +R Y D+ ++++ + FKK+L I + N+K T G+N+FAD+T EE Sbjct: 55 SRVYSDELEKQMRFDVFKKNLKFIEKFNKKGDRTYKLGVNEFADWTREE 103 >At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XCP2) identical to papain-type cysteine endopeptidase XCP2 GI:6708183 from [Arabidopsis thaliana] Length = 356 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = +3 Query: 219 LFEIFVKXHNREYKDDADRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEE-QQ 395 LFE ++ + Y+ ++ L ++ FK +L I++ N+K G+N+FAD + EE ++ Sbjct: 50 LFENWISNFEKAYETVEEKFLRFEVFKDNLKHIDETNKKGKSYWLGLNEFADLSHEEFKK 109 Query: 396 SRLGLR 413 LGL+ Sbjct: 110 MYLGLK 115 >At5g60360.1 68418.m07568 cysteine proteinase, putative / AALP protein (AALP) identical to AALP protein GI:7230640 from [Arabidopsis thaliana]; similar to barley aleurain Length = 358 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +3 Query: 222 FEIFVKXHNREYKDDADRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEE-QQS 398 F F + ++Y++ + +L + FK++L I N+K G+N+FAD T +E Q++ Sbjct: 59 FARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRT 118 Query: 399 RLG 407 +LG Sbjct: 119 KLG 121 >At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol protease identical to SP|P43297 Cysteine proteinase RD21A precursor (EC 3.4.22.-) {Arabidopsis thaliana}, thiol protease RD21A SP:P43297 from [Arabidopsis thaliana] Length = 462 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/72 (26%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Frame = +3 Query: 219 LFEIFVKXHNREYKDDA--DRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEEQ 392 ++E ++ H + ++ +++ ++ FK +L +++ NEKN G+ +FAD T +E Sbjct: 49 IYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYRLGLTRFADLTNDEY 108 Query: 393 QSR-LGLRLPAK 425 +S+ LG ++ K Sbjct: 109 RSKYLGAKMEKK 120 >At3g43960.1 68416.m04706 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 376 Score = 37.9 bits (84), Expect = 0.009 Identities = 34/128 (26%), Positives = 66/128 (51%), Gaps = 8/128 (6%) Frame = +3 Query: 123 FVSVALLIATVVMAS-SAEPXXPSHYALNQAKXL--FEIFVKXHNREYKDDADRELHYQS 293 F ++ALL +V++ S S + N+ + L +E ++ + + Y ++E ++ Sbjct: 5 FRTLALLTLSVLLISISLGVVTATESQRNEGEVLTMYEQWLVENGKNYNGLGEKERRFKI 64 Query: 294 FKKHLAEINQLN-EKNPYTTFGINKFADYTPEE-QQSRLGLRLPAKK-T*VLRLQXYR-- 458 FK +L I + N + N G+NKF+D T +E Q S LG ++ K + V Y+ Sbjct: 65 FKDNLKRIEEHNSDPNRSYERGLNKFSDLTADEFQASYLGGKMEKKSLSDVAERYQYKEG 124 Query: 459 NAIPNEIN 482 + +P+E++ Sbjct: 125 DVLPDEVD 132 >At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol protease, putative similar to cysteine proteinase RD21A precursor (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 463 Score = 36.7 bits (81), Expect = 0.020 Identities = 22/80 (27%), Positives = 45/80 (56%), Gaps = 5/80 (6%) Frame = +3 Query: 204 NQAKXLFEIFVKXHNREYKDD----ADRELHYQSFKKHLAEINQLNEKNPYTTFGINKFA 371 ++ + ++E ++ H ++ + A+++ ++ FK +L I++ N KN G+ +FA Sbjct: 44 SEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNLRFIDEHNTKNLSYKLGLTRFA 103 Query: 372 DYTPEEQQSR-LGLRLPAKK 428 D T EE +S LG + P K+ Sbjct: 104 DLTNEEYRSMYLGAK-PTKR 122 >At4g11320.1 68417.m01828 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 371 Score = 35.9 bits (79), Expect = 0.036 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +3 Query: 207 QAKXLFEIFVKXHNREYKDDADRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPE 386 +A +FE ++ H + Y A++E F+ +L I N +N G+N+FAD + Sbjct: 51 EATLMFESWMVKHGKVYDSVAEKERRLTIFEDNLRFITNRNAENLSYRLGLNRFADLSLH 110 Query: 387 E 389 E Sbjct: 111 E 111 >At3g45310.1 68416.m04892 cysteine proteinase, putative similar to AALP protein GI:7230640 from [Arabidopsis thaliana] and barley aleurain Length = 358 Score = 35.9 bits (79), Expect = 0.036 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 222 FEIFVKXHNREYKDDADRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEE-QQS 398 F F + ++Y+ + +L + FK++L I N+K +N+FAD T +E Q+ Sbjct: 59 FSRFTHRYGKKYQSVEEMKLRFSVFKENLDLIRSTNKKGLSYKLSLNQFADLTWQEFQRY 118 Query: 399 RLG 407 +LG Sbjct: 119 KLG 121 >At4g16190.1 68417.m02457 cysteine proteinase, putative contains similarity to papain-like cysteine proteinase isoform I GI:7381219 from [Ipomoea batatas] Length = 373 Score = 35.5 bits (78), Expect = 0.047 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +3 Query: 201 LNQAKXLFEIFVKXHNREYKDDADRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYT 380 L A+ F +F + + Y + + ++ FK +L + +P G+ +F+D T Sbjct: 48 LLNAEHHFTLFKSKYEKTYATQVEHDHRFRVFKANLRRARRNQLLDPSAVHGVTQFSDLT 107 Query: 381 PEE-QQSRLGLR 413 P+E ++ LGL+ Sbjct: 108 PKEFRRKFLGLK 119 >At1g29080.1 68414.m03560 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 346 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 1/92 (1%) Frame = +3 Query: 117 MHFVSVALLIATVVMASSAEPXXPSHYALNQAKXLFEIFVKXHNREYKDDADRELHYQSF 296 + FV V L I + + S + Y + + ++ +R Y D+ +++L Q Sbjct: 4 VEFVCVVLTIFFMDLKISEATSRVALYKPSSIVDYHQQWMIQFSRVYDDEFEKQLRLQVL 63 Query: 297 KKHLAEINQLNEK-NPYTTFGINKFADYTPEE 389 ++L I N N G+N+F D+T EE Sbjct: 64 TENLKFIESFNNMGNQSYKLGVNEFTDWTKEE 95 >At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG12) / cysteine proteinase, putative identical to senescence-specific protein SAG12 GI:1046373 from [Arabidopsis thaliana] Length = 346 Score = 33.1 bits (72), Expect = 0.25 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 243 HNREYKDDADRELHYQSFKKHLAEINQLNEKNPYTTF--GINKFADYTPEEQQS 398 H R Y D + Y FK ++ I LN TF +N+FAD T +E +S Sbjct: 45 HGRVYADVKEENNRYVVFKNNVERIEHLNSIPAGRTFKLAVNQFADLTNDEFRS 98 >At3g48340.1 68416.m05276 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 351 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 270 DRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEE 389 +RE + F+ ++ ++ N+KN +NKFAD T E Sbjct: 53 EREKRFNVFRHNVMHVHNTNKKNRSYKLKLNKFADLTINE 92 >At5g66210.2 68418.m08341 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 279 LHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEEQQSRLGLR 413 LH ++H +E QL + + F ++K TPEE + GLR Sbjct: 432 LHVHQLEEHDSEKWQLRSRAAFEKFDLDKDGYITPEELRMHTGLR 476 >At5g66210.1 68418.m08340 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 279 LHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEEQQSRLGLR 413 LH ++H +E QL + + F ++K TPEE + GLR Sbjct: 432 LHVHQLEEHDSEKWQLRSRAAFEKFDLDKDGYITPEELRMHTGLR 476 >At5g50260.1 68418.m06224 cysteine proteinase, putative similar to cysteine endopeptidase precursor CysEP GI:2944446 from [Ricinus communis] Length = 361 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +3 Query: 237 KXHNREYKDDADRELHYQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEE 389 + H+ + ++ + FK ++ I++ N+K+ +NKF D T EE Sbjct: 42 RSHHTVARSLEEKAKRFNVFKHNVKHIHETNKKDKSYKLKLNKFGDMTSEE 92 >At2g38120.1 68415.m04679 amino acid permease, putative (AUX1) identical to AUX1 GI:1531758 from [Arabidopsis thaliana] Length = 485 Score = 28.7 bits (61), Expect = 5.4 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%) Frame = -1 Query: 533 LLIIFDKF*TFYKQSQYIYFVWNSIPIXLKSQNLCL--LSRQPQSQPALLFLRSIISKFV 360 +L++ +F TF +YFVW + ++++CL L+R P P + FL I F Sbjct: 316 ILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIP-IWFLAIIFPFFG 374 Query: 359 NAKRSIWILLVQL-VYL 312 ++ LLV VY+ Sbjct: 375 PINSAVGALLVSFTVYI 391 >At3g60290.1 68416.m06739 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to flavonol synthase 1 [SP|Q96330], gibberellin 20-oxidase [GI:9791186]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 316 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 246 NREYKDDADRELHYQSFKKHLAEINQL-NEKNP--YTTFGINKFADY 377 N++YK + LH K ++ QL NE P Y F N F DY Sbjct: 250 NKDYKRLSFASLHSLPMHKKISPATQLVNENKPAAYGEFSFNDFLDY 296 >At3g48350.1 68416.m05277 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 364 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 285 YQSFKKHLAEINQLNEKNPYTTFGINKFADYTPEEQQS 398 + F+ ++ +++ N+KN IN+FAD T E +S Sbjct: 58 FNVFRHNVLHVHRTNKKNKPYKLKINRFADITHHEFRS 95 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,774,323 Number of Sequences: 28952 Number of extensions: 172711 Number of successful extensions: 353 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2067932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -