BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H23 (976 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosacchar... 28 2.3 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 27 3.0 >SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 27.9 bits (59), Expect = 2.3 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +2 Query: 191 SSFTNSVVVADYDSAVEKSKHLYEEKKSEVITN-CREQTDTKQQDEL---HGSTPINFGL 358 SS VV D+DS +++K Y+E ++ + C+ TD + ++ HG I F L Sbjct: 394 SSLKPDYVVGDFDSLTDETKAYYKEMGVNIVFDPCQNTTDFMKCHKIIKEHGIDTI-FVL 452 Query: 359 QGLQG 373 G+ G Sbjct: 453 CGMGG 457 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 27.5 bits (58), Expect = 3.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 305 DTKQQDELHGSTPINFGLQGLQGTSSG 385 DT+ ++ TP+N+G G Q TS G Sbjct: 1264 DTQAYYNMNAQTPVNYGFAGGQDTSFG 1290 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,421,017 Number of Sequences: 5004 Number of extensions: 38727 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 501293686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -