BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H23 (976 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 3.4 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 6.0 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 25.0 bits (52), Expect = 3.4 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +2 Query: 332 GSTPIN-FGLQGLQGTSSGDCFPV 400 G IN GL +GT SGD FP+ Sbjct: 416 GGISINDLGLDDFRGTCSGDKFPI 439 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.2 bits (50), Expect = 6.0 Identities = 20/79 (25%), Positives = 22/79 (27%), Gaps = 4/79 (5%) Frame = +2 Query: 644 GHWGVXXXPGTXGPXXALPXX----NXRPXXXPXPXXXPXXPAXXPTX*PFXFPTXFPPX 811 G+ G G GP P N P P P P FP FP Sbjct: 517 GYDGRDLTGGPLGPPPPPPPGGAVLNIPPQFLPPPLNLLRAPFFPLNPAQLRFPAGFPNL 576 Query: 812 XXXPXXLXPXPXAXLXPPP 868 P P + PPP Sbjct: 577 PNAQPPPAPPPPPPMGPPP 595 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,643 Number of Sequences: 2352 Number of extensions: 10184 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 106474641 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -