BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H22 (908 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81517-3|CAB04210.1| 802|Caenorhabditis elegans Hypothetical pr... 30 2.6 AC006696-8|AAF39989.1| 120|Caenorhabditis elegans Hypothetical ... 28 8.0 >Z81517-3|CAB04210.1| 802|Caenorhabditis elegans Hypothetical protein F28B1.3 protein. Length = 802 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = +2 Query: 362 PIKLTKMDVKSVISMRYAHTAIVAHVRNAANKSQEANFXVLLPEHSFHQRICYDSGWKIL 541 P K D K + + +A + I+AH + S + P+ + +C DSGW+I Sbjct: 165 PKKKWTNDCKKLRPVCFAVSGILAHYADFFPYSALSVLRGFYPDLTLVTAVCVDSGWQIN 224 Query: 542 QSVRQRKERGCSNI 583 Q E C+++ Sbjct: 225 GVKVQNPEVTCNSV 238 >AC006696-8|AAF39989.1| 120|Caenorhabditis elegans Hypothetical protein W08E12.2 protein. Length = 120 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 340 SNGGTCSTNKTDEDGCEVRDIYAIRSHGYCSAC 438 +N CS N + GC R Y + GY S C Sbjct: 60 NNNNGCSCNPCNGGGCAPRCSYCPNNFGYSSCC 92 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,638,637 Number of Sequences: 27780 Number of extensions: 421806 Number of successful extensions: 1153 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2318293978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -