BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H22 (908 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 5.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 5.1 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 8.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 8.9 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 5.1 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = -3 Query: 204 FSDIVTVLLIFNGTIYSIRFQALARSVTNNK 112 FS + LLI T+Y+++ + + + +K Sbjct: 676 FSQLYNALLILISTVYAVKTRKIPENFNESK 706 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 5.1 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = -3 Query: 204 FSDIVTVLLIFNGTIYSIRFQALARSVTNNK 112 FS + LLI T+Y+++ + + + +K Sbjct: 766 FSQLYNALLILISTVYAVKTRKIPENFNESK 796 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 6.7 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = +2 Query: 509 RICYDSGWKILQSVRQRKERGCSNI 583 ++ Y W++ ++ R E CS I Sbjct: 97 KVTYSGLWRVCVAISSRMEYECSRI 121 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 8.9 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 263 TITTPETMVVSRSDDAETEATLDVDTVTEGPVQPIKLTKMDVKSVIS 403 TI TP T V+S S +L + + + K DVK+ I+ Sbjct: 838 TINTPTTSVISMSGTTVPITSLPASSTSINSITVEKDVINDVKTQIT 884 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 8.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 261 PQLRPQRPWWCP 296 PQL+PQ+P+ P Sbjct: 1124 PQLKPQKPFTSP 1135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,401 Number of Sequences: 438 Number of extensions: 5126 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29509116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -