BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H20 (1147 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 38 0.019 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 38 0.019 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 38 0.019 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 38 0.019 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 38 0.026 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 38 0.026 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 38 0.026 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 37 0.060 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 37 0.060 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 37 0.060 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 37 0.060 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 37 0.060 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 37 0.060 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 37 0.060 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 37 0.060 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 34 0.42 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 33 0.55 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 33 0.55 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 33 0.55 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 33 0.55 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 33 0.55 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 33 0.55 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 33 0.55 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 33 0.55 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 33 0.97 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 33 0.97 J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.me... 32 1.7 DQ017435-1|AAY82217.1| 53|Drosophila melanogaster CG10002 prot... 32 1.7 DQ017434-1|AAY82216.1| 53|Drosophila melanogaster CG10002 prot... 32 1.7 BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p pro... 32 1.7 BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p pro... 32 1.7 AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-P... 32 1.7 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 31 2.2 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 31 2.2 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 31 3.9 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 31 3.9 AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-P... 30 5.2 AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-P... 30 5.2 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 38.3 bits (85), Expect = 0.019 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPP P G G P PPPPP G PPPP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 37.1 bits (82), Expect = 0.045 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPP P G PPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 33.9 bits (74), Expect = 0.42 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP GGG P PPP P PPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 38.3 bits (85), Expect = 0.019 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPP P G G P PPPPP G PPPP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 37.1 bits (82), Expect = 0.045 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPP P G PPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 33.9 bits (74), Expect = 0.42 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP GGG P PPP P PPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 38.3 bits (85), Expect = 0.019 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPP P G G P PPPPP G PPPP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 37.1 bits (82), Expect = 0.045 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPP P G PPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 33.9 bits (74), Expect = 0.42 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP GGG P PPP P PPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 38.3 bits (85), Expect = 0.019 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPP P G G P PPPPP G PPPP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 37.1 bits (82), Expect = 0.045 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPP P G PPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 33.9 bits (74), Expect = 0.42 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP GGG P PPP P PPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 37.9 bits (84), Expect = 0.026 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPPTKKKXXXXXXXGXG 641 PPP P G G P PPPPP G PPPP +K Sbjct: 383 PPPPPAPPAGVPPAPPPMPVFGAGGAP-PPPPPPSSGMAGVPPPPPMQKSQPKAVSAAST 441 Query: 640 GG 635 GG Sbjct: 442 GG 443 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 37.9 bits (84), Expect = 0.026 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPPTKKKXXXXXXXGXG 641 PPP P G G P PPPPP G PPPP +K Sbjct: 383 PPPPPAPPAGVPPAPPPMPVFGAGGAP-PPPPPPSSGMAGVPPPPPMQKSQPKAVSAAST 441 Query: 640 GG 635 GG Sbjct: 442 GG 443 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 37.9 bits (84), Expect = 0.026 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPPTKKKXXXXXXXGXG 641 PPP P G G P PPPPP G PPPP +K Sbjct: 499 PPPPPAPPAGVPPAPPPMPVFGAGGAP-PPPPPPSSGMAGVPPPPPMQKSQPKAVSAAST 557 Query: 640 GG 635 GG Sbjct: 558 GG 559 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 507 PPPPPPLANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 552 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 521 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 567 Score = 30.7 bits (66), Expect = 3.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 504 PPPPPPPPPLANYGAPPPPP 523 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 602 PPPPPPMANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 647 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 616 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 662 Score = 31.1 bits (67), Expect = 3.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 599 PPPPPPPPPMANYGAPPPPP 618 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 735 PPPPPPMANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 780 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 749 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 795 Score = 31.1 bits (67), Expect = 3.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 732 PPPPPPPPPMANYGAPPPPP 751 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 543 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 512 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 558 Score = 30.7 bits (66), Expect = 3.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 495 PPPPPPPPPLANYGAPPPPP 514 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 508 PPPPPPLANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 553 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 522 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 568 Score = 30.7 bits (66), Expect = 3.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 505 PPPPPPPPPLANYGAPPPPP 524 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 543 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 512 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 558 Score = 30.7 bits (66), Expect = 3.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 495 PPPPPPPPPLANYGAPPPPP 514 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 656 PPPPPPLANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 701 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 670 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 716 Score = 30.7 bits (66), Expect = 3.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 653 PPPPPPPPPLANYGAPPPPP 672 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 36.7 bits (81), Expect = 0.060 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G G P PPPP + G PPPP Sbjct: 603 PPPPPPLANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGGGGIPPPPP 648 Score = 31.9 bits (69), Expect = 1.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG G P PPPP P P Sbjct: 617 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAP 663 Score = 30.7 bits (66), Expect = 3.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP G PPPP Sbjct: 600 PPPPPPPPPLANYGAPPPPP 619 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 33.9 bits (74), Expect = 0.42 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKK 674 PPPPP K PPPPTKK Sbjct: 168 PPPPPTKKVVYTPPPPPPTKK 188 Score = 33.9 bits (74), Expect = 0.42 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKK 674 PPPPP K PPPPTKK Sbjct: 181 PPPPPTKKVVYTPPPPPPTKK 201 Score = 33.9 bits (74), Expect = 0.42 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKK 674 PPPPP K PPPPTKK Sbjct: 281 PPPPPTKKVVYTPPPPPPTKK 301 Score = 31.1 bits (67), Expect = 3.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKKK 671 PPPPP K PPPP KK Sbjct: 194 PPPPPTKKVVYTPPPPPPPPKK 215 Score = 31.1 bits (67), Expect = 3.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKKK 671 PPPPP K PPPP KK Sbjct: 294 PPPPPTKKVVYTPPPPPPPPKK 315 Score = 30.7 bits (66), Expect = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKKK 671 PPPPP K PPPP KK Sbjct: 167 PPPPPPTKKVVYTPPPPPPTKK 188 Score = 30.7 bits (66), Expect = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKKK 671 PPPPP K PPPP KK Sbjct: 180 PPPPPPTKKVVYTPPPPPPTKK 201 Score = 30.7 bits (66), Expect = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 736 PPPPPXXKXXXGXXPPPPTKKK 671 PPPPP K PPPP KK Sbjct: 280 PPPPPPTKKVVYTPPPPPPTKK 301 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 376 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 435 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 465 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 417 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Query: 584 PXXGG 570 P GG Sbjct: 477 PGLGG 481 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 379 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 438 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 439 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 468 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 420 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Query: 584 PXXGG 570 P GG Sbjct: 480 PGLGG 484 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 522 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 581 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 582 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 611 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 563 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 622 Query: 584 PXXGG 570 P GG Sbjct: 623 PGLGG 627 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 521 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 580 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 581 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 610 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 562 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Query: 584 PXXGG 570 P GG Sbjct: 622 PGLGG 626 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 376 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 435 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 465 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 417 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Query: 584 PXXGG 570 P GG Sbjct: 477 PGLGG 481 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 376 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 435 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 465 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 417 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Query: 584 PXXGG 570 P GG Sbjct: 477 PGLGG 481 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 376 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 435 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 465 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 417 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Query: 584 PXXGG 570 P GG Sbjct: 477 PGLGG 481 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 33.5 bits (73), Expect = 0.55 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXG-GGXGXPX----PPPPPXXKXXXGXXPPPPTKKKXXXX 659 PPP P + GG G P PPPPP G PPPP + Sbjct: 379 PPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNG 438 Query: 658 XXXGXG-GGXXFXXXPXXXXXXXXPPPGXG 572 GG P PPP G Sbjct: 439 APPPPAMGGGPPPAPPAPPAMGGGPPPAPG 468 Score = 29.5 bits (63), Expect = 9.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GGXGXPXPPPPPXXKXXXGXXXXPP--NXKKKXXXXXXGXGGGXXXXXXPPXXXXXXPPP 585 GG PPPP + G P GGG P PPP Sbjct: 420 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Query: 584 PXXGG 570 P GG Sbjct: 480 PGLGG 484 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 32.7 bits (71), Expect = 0.97 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 754 GXGXPXPPPPPXXKXXXGXXPPPP 683 G G P PPPPP + G PP P Sbjct: 221 GYGPPPPPPPPKPQPTPGYGPPTP 244 Score = 31.9 bits (69), Expect = 1.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP + G PPPP Sbjct: 208 PPPPPPPRPQPTPGYGPPPP 227 Score = 31.5 bits (68), Expect = 2.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPP-PXXKXXXGXXPPPPTKK 674 PP P P E P PPPP P G PPPP K Sbjct: 182 PPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPK 232 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 32.7 bits (71), Expect = 0.97 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 754 GXGXPXPPPPPXXKXXXGXXPPPP 683 G G P PPPPP + G PP P Sbjct: 221 GYGPPPPPPPPKPQPTPGYGPPTP 244 Score = 31.9 bits (69), Expect = 1.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 742 PXPPPPPXXKXXXGXXPPPP 683 P PPPPP + G PPPP Sbjct: 208 PPPPPPPRPQPTPGYGPPPP 227 Score = 31.5 bits (68), Expect = 2.2 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPP-PXXKXXXGXXPPPPTKK 674 PP P P E P PPPP P G PPPP K Sbjct: 182 PPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPK 232 >J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.melanogaster forkhead protein (fkh) gene, complete cds. ). Length = 510 Score = 31.9 bits (69), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 687 GGGXXPXXXFXXGGGGGXGXPXPP 758 GGG P GGGGG G P PP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >DQ017435-1|AAY82217.1| 53|Drosophila melanogaster CG10002 protein. Length = 53 Score = 31.9 bits (69), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 687 GGGXXPXXXFXXGGGGGXGXPXPP 758 GGG P GGGGG G P PP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >DQ017434-1|AAY82216.1| 53|Drosophila melanogaster CG10002 protein. Length = 53 Score = 31.9 bits (69), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 687 GGGXXPXXXFXXGGGGGXGXPXPP 758 GGG P GGGGG G P PP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p protein. Length = 510 Score = 31.9 bits (69), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 687 GGGXXPXXXFXXGGGGGXGXPXPP 758 GGG P GGGGG G P PP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p protein. Length = 426 Score = 31.9 bits (69), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 687 GGGXXPXXXFXXGGGGGXGXPXPP 758 GGG P GGGGG G P PP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-PA protein. Length = 510 Score = 31.9 bits (69), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 687 GGGXXPXXXFXXGGGGGXGXPXPP 758 GGG P GGGGG G P PP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 31.5 bits (68), Expect = 2.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G P PPPPP PPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAA---PPPPPPPMINGGALPPPPPP 314 Score = 30.3 bits (65), Expect = 5.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG P PPPPP + P P Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGG-ALPPPPPPPSMQMASRPRTPDP 328 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 31.5 bits (68), Expect = 2.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P G P PPPPP PPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAA---PPPPPPPMINGGALPPPPPP 314 Score = 30.3 bits (65), Expect = 5.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPP 683 PPPP P GG P PPPPP + P P Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGG-ALPPPPPPPSMQMASRPRTPDP 328 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 30.7 bits (66), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPP-----PPPXXKXXXGXXPPPP 683 PPP P GGG P P PPP G PPPP Sbjct: 165 PPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPP 215 Score = 29.5 bits (63), Expect = 9.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPP 686 PPPP P GGG PPPP G PPP Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGGG------PPPPRPGWNGGGPPPP 215 >AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA protein. Length = 362 Score = 30.7 bits (66), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = -1 Query: 820 PPPXPXXEXXXXXXXXXXXXGGGXGXPXPP-----PPPXXKXXXGXXPPPP 683 PPP P GGG P P PPP G PPPP Sbjct: 165 PPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPP 215 Score = 29.5 bits (63), Expect = 9.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 823 PPPPXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPP 686 PPPP P GGG PPPP G PPP Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGGG------PPPPRPGWNGGGPPPP 215 >AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-PA, isoform A protein. Length = 858 Score = 30.3 bits (65), Expect = 5.2 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 823 PPP--PXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPPTKK 674 PPP P + GGG P PPPPP PPPP +K Sbjct: 493 PPPVRPPQSVQDADELFMADLKDGGGGAVPRPPPPP---------PPPPPRK 535 >AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-PB, isoform B protein. Length = 968 Score = 30.3 bits (65), Expect = 5.2 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 823 PPP--PXPXXEXXXXXXXXXXXXGGGXGXPXPPPPPXXKXXXGXXPPPPTKK 674 PPP P + GGG P PPPPP PPPP +K Sbjct: 603 PPPVRPPQSVQDADELFMADLKDGGGGAVPRPPPPP---------PPPPPRK 645 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,782,270 Number of Sequences: 53049 Number of extensions: 769424 Number of successful extensions: 7425 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5386 length of database: 24,988,368 effective HSP length: 86 effective length of database: 20,426,154 effective search space used: 6025715430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -