BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H19 (856 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 25 0.76 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 4.1 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.4 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 9.4 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.0 bits (52), Expect = 0.76 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 296 SKTARGTPWNFAYQLWTKDGKEIVKSYFPI-QFRVIFTEQTVKLINKRDHHALKLI 460 S++ RG N+ T KE++ F + +FR+ Q K+I + DH ALK + Sbjct: 632 SRSLRGPELNY-----TTTEKELLGVIFALHKFRIYI--QVTKIIIRTDHQALKFL 680 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 4.1 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 515 CWFCLWSHRMQFCCGFV 465 C F +++ + FCC F+ Sbjct: 171 CAFIIFTMHLLFCCAFI 187 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 522 TFLLVLSLESPNAILLWFCXSINLRA*WSLLFMSLTV 412 T+L+ E + +LW C S N +L +S TV Sbjct: 242 TYLIWTIYEMYHLAILWSCTSTNCPRFLIMLALSYTV 278 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 562 VYFKIMSTEDKQYLKLDNTK 621 VY+K +ST+DK +K + K Sbjct: 1236 VYYKPVSTDDKTEVKPTSQK 1255 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 9.4 Identities = 12/52 (23%), Positives = 20/52 (38%) Frame = +2 Query: 425 INKRDHHALKLIXQQNHNKIAFGDSKDKTSKKVSWXVYPRVWKTTEFTSRSC 580 + K+ + L Q+NH KI++ + R+W T R C Sbjct: 301 VQKKLQKEIDLTLQENHGKISYNVLQSMKYLDQVVCESLRLWPPAPQTDRLC 352 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,385 Number of Sequences: 336 Number of extensions: 3391 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -