BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H18 (896 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0366 - 28313190-28313601,28313759-28314225,28315044-283157... 29 3.8 >02_05_0366 - 28313190-28313601,28313759-28314225,28315044-28315782, 28316548-28316615,28316693-28316757,28316922-28320162, 28320239-28320301,28320756-28320824,28321020-28321055, 28322035-28322280,28322531-28322569,28322695-28322816, 28322921-28323004,28323100-28323235,28323486-28323535, 28323620-28323756,28323863-28323951,28324847-28324954, 28325080-28325163,28325841-28325888,28326036-28326153, 28328262-28328347 Length = 2168 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = -1 Query: 197 YSTTITQSLITDHCRNQGVDSRRISEEQRAQDVAREGAHAPGPT 66 YST + ++L+ +NQ DS + ++ + Q++A+E +A PT Sbjct: 179 YSTMLAENLVDVRLQNQENDSLQTNQRSQ-QELAQENINASSPT 221 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,700,440 Number of Sequences: 37544 Number of extensions: 261531 Number of successful extensions: 516 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -