BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H14 (870 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 2.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 3.1 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 5.5 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 5.5 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 5.5 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.5 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 432 LGHKDGIYVYDTETEKLEKYGNLSDS 509 +GH Y++D + LE +G + DS Sbjct: 365 MGHVFISYIHDPDHRHLESFGVMGDS 390 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 3.1 Identities = 15/53 (28%), Positives = 20/53 (37%) Frame = -1 Query: 777 DWSXKERXXGWIGWKTFDLVRTVRKXQHTVDCSLRCSTSXHPSPALFAQHAQP 619 DW K G D+V T + Q T S+ +TS +P QP Sbjct: 1321 DWPEKATCDGTSNVNVVDIVTTAKPAQSTT--SVSTTTSWNPGSTTNYPEWQP 1371 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 309 NAGLILWF*NQRFRWCCRGLSCYYSRWSYSVD 214 NA L +R + C G+ ++ +W+YS D Sbjct: 50 NASAPLHIPAKRAAYDCEGVIRHHGQWNYSPD 81 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 548 VHSDGRPRRLQGHRGRHQEDQGQR 619 ++S PR+ RGRH + + +R Sbjct: 194 LNSKSLPRQYSQSRGRHNQSRSKR 217 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 489 TSQASLFLCRKRRYRPYGPNRRVTS 415 T+ + L RK ++ PYGP ++ S Sbjct: 62 TNNSDLRCKRKIQFMPYGPQQQPAS 86 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 368 FAVLVGVYTLVLFLVTRSYV 309 + V V ++ L FL+ RSY+ Sbjct: 181 YKVFVDLFNLSTFLIPRSYI 200 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 368 FAVLVGVYTLVLFLVTRSYV 309 + V V ++ L FL+ RSY+ Sbjct: 341 YKVFVDLFNLSTFLIPRSYI 360 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 368 FAVLVGVYTLVLFLVTRSYV 309 + V V ++ L FL+ RSY+ Sbjct: 341 YKVFVDLFNLSTFLIPRSYI 360 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,069 Number of Sequences: 336 Number of extensions: 3218 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23996456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -