BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H12 (915 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 4.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 5.8 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 5.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.8 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 7.7 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 4.4 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 638 IQKIPSRHHRSKQ*SFXKGIDTFTLHFFKLLRTESNFRMIIIKVI 772 + +I +H+ + + + + FT H LLR +S R I K I Sbjct: 151 LAQIRQIYHQELE-KYEQACNEFTTHVMNLLREQSRTRPITPKEI 194 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPAS 171 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 254 SQVTSRGCRFEKCPLIGYPSSYSQ 183 ++ + CR KC L+G S S+ Sbjct: 54 NRTACKACRLRKCLLVGMSKSGSR 77 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 90 NSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 127 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVA 509 NS T +SGL P S T PP + + + P + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPAS 171 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.8 bits (44), Expect = 7.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 622 NSAWTPTSGLL*PNSFETIPPAE 554 NS T +SGL P S T PP + Sbjct: 134 NSNATKSSGLTSPLSVSTSPPGK 156 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,631 Number of Sequences: 336 Number of extensions: 3997 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25547951 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -