BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H12 (915 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 30 2.3 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 29 6.9 SB_4104| Best HMM Match : Fzo_mitofusin (HMM E-Value=0) 28 9.2 >SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1297 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +1 Query: 259 QVGGGKVFGTLGQNDDGLFGKAGYNREIFNDDRGKLTGQAYG 384 Q G G FGT GLFG AG N G +TG +G Sbjct: 48 QTGFGSGFGTTQTTGTGLFGAAGTNTGTGLFGGGTVTGSMFG 89 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 30.3 bits (65), Expect = 2.3 Identities = 24/71 (33%), Positives = 32/71 (45%) Frame = -3 Query: 619 SAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVAVIPDLPPICLFISIAASAFLLAQ 440 S + P+SG+ P PP+ VF S S P PV P PP +F A S+ + Sbjct: 424 SVFAPSSGV--PTPVAAPPPS---VFASSSGVPTPVTAPPPAPPPSVF---APSSGVPTP 475 Query: 439 SRRPP*FVLSP 407 PP V +P Sbjct: 476 VAAPPPSVFAP 486 Score = 29.5 bits (63), Expect = 4.0 Identities = 24/71 (33%), Positives = 33/71 (46%) Frame = -3 Query: 619 SAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVAVIPDLPPICLFISIAASAFLLAQ 440 S + +SG+ P + PP+ VF S S P PVA P PP +F A S+ + Sbjct: 366 SVFASSSGV--PTPVKAPPPS---VFASSSGVPTPVAAPPPAPPPSVF---APSSGVPTP 417 Query: 439 SRRPP*FVLSP 407 PP V +P Sbjct: 418 VAAPPPSVFAP 428 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 619 SAWTPTSGLL*PNSFETIPPAER-RVFLSRSHTPEPVAVIPDLPPICLFISIAA 461 S + P+SG+ P PPA VF S P PV P PP +F +A Sbjct: 522 SVFAPSSGV--PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSA 573 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 251 QVTSRGCRFEKCPLIGYPSSYSQ*TSALTHTRT 153 ++T GC FE P + +P+SY + T+T Sbjct: 2867 ELTKEGCVFETAPAVSHPASYVDEDGRVWATKT 2899 >SB_4104| Best HMM Match : Fzo_mitofusin (HMM E-Value=0) Length = 613 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = -1 Query: 444 PSLDVHRSLYCHPAGPRXPGAVGLPGQFAAVIIEDLSVVTGFTKKPIIVLA 292 PS D HR L PAGP P + +I ++ +T T ++VLA Sbjct: 426 PSTDHHRELEPRPAGPVMPRCSYSDEEMTLAVIHGVASLTSRT-ATVVVLA 475 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,177,556 Number of Sequences: 59808 Number of extensions: 515711 Number of successful extensions: 1239 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1238 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -