BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H12 (915 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 25 3.2 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 4.2 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 25 4.2 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 22 4.5 AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. 24 7.4 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 23 9.8 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 9.8 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 25.0 bits (52), Expect = 3.2 Identities = 11/39 (28%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = +2 Query: 242 TSPGTNK---WEEGRSSARWAKTMMGFLVKPVTTERSSM 349 TSP K W++G +WA+ + LVK + + ++ Sbjct: 24 TSPAVKKLLGWKQGDEEEKWAEKAVDSLVKKLKKRKGAI 62 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 24.6 bits (51), Expect = 4.2 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 408 GDSTNYGGRLDWANKNAEAAIDINRQIGGRSGMTATGSGV 527 G S++ GG + + A AA+ GG +GM +TG+GV Sbjct: 683 GRSSSGGGMIGMHSVAAGAAVAAG---GGVAGMMSTGAGV 719 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 24.6 bits (51), Expect = 4.2 Identities = 9/18 (50%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = +1 Query: 166 VNAEVYWEYE-EGYPISG 216 +N E+YWE++ G PI G Sbjct: 59 INEELYWEFKNRGEPIGG 76 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 21.8 bits (44), Expect(2) = 4.5 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 390 PGAVGLPGQ 364 PG +GLPGQ Sbjct: 196 PGVIGLPGQ 204 Score = 20.6 bits (41), Expect(2) = 4.5 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -1 Query: 411 HPAGPRXPGAVGLPG 367 HP P PG G+ G Sbjct: 171 HPGAPGRPGVDGVKG 185 >AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. Length = 99 Score = 23.8 bits (49), Expect = 7.4 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 135 IIFLRHGPGVCQRRSLLGVR 194 +++L PG C+R LG++ Sbjct: 18 LVYLEPSPGFCERNPRLGIQ 37 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 23.4 bits (48), Expect = 9.8 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 414 STNYGGRLDWANKNAEAAIDINR 482 +T GGRL + + E ++D++R Sbjct: 80 TTAVGGRLSYLTRTDEPSVDVSR 102 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 109 SQVKMNSKLLYFFATVLVCVNAEVYWEYEEGYPISGH 219 SQ+K+ +K+L ++V VC+N Y + +GH Sbjct: 316 SQMKV-TKMLLIVSSVFVCLNLPSYVMRVRAFVETGH 351 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 806,539 Number of Sequences: 2352 Number of extensions: 16948 Number of successful extensions: 28 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99228240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -