BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H11 (918 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 27 2.8 SPCC584.01c |||sulfite reductase NADPH flavoprotein subunit |Sch... 26 8.6 >SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 589 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 505 CMDELTAHXVLNSYW-SPXPIYN 440 C+ E T+H N+ W SP PI+N Sbjct: 281 CVLEFTSHEAANNAWSSPEPIFN 303 >SPCC584.01c |||sulfite reductase NADPH flavoprotein subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 1006 Score = 25.8 bits (54), Expect = 8.6 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +2 Query: 44 FDSSQHIVKMAPNITSSCFLLVSLMALAASKSLFEKSCPENAHTTLNPL 190 F ++ + + +S FLL S A +S ++ P + + LNPL Sbjct: 56 FSNNVELFNLEARSGASAFLLGSYTAAISSPGVYSMMTPSSCLSLLNPL 104 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,667,901 Number of Sequences: 5004 Number of extensions: 46799 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -