BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H11 (918 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33414| Best HMM Match : TSP_1 (HMM E-Value=0.00041) 32 0.75 SB_25647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 >SB_33414| Best HMM Match : TSP_1 (HMM E-Value=0.00041) Length = 428 Score = 31.9 bits (69), Expect = 0.75 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = -2 Query: 359 KSKSVEIASASYSTFGNGHAFSLRVEEVSQNHSGXVAMKAVTQLVCFNSGSAQVGTAGGS 180 +S + + SA S + A S V+ +SQ + A + + N+GSA + G + Sbjct: 209 RSLTAMVHSAGQSIKDSPSASSPLVKAISQIETSATATSLIRPTITLNTGSAMTTSIGPT 268 Query: 179 M---SCEHFQDTISRT 141 M S EH Q T S T Sbjct: 269 MNPTSSEHVQSTKSLT 284 >SB_25647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 108 TSKKHDEVMFGAILTMCCELS 46 TS+KHDE +FG L C ++S Sbjct: 7 TSRKHDEGLFGRFLVRCDDIS 27 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,524,988 Number of Sequences: 59808 Number of extensions: 366480 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2657535823 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -