BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H11 (918 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14800.1 68415.m01677 hypothetical protein 29 4.3 At2g13770.1 68415.m01521 hypothetical protein 29 5.7 >At2g14800.1 68415.m01677 hypothetical protein Length = 580 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 163 FRTRFLEQALTGCESHQRHEQE 98 F+T E+A+TG E Q HEQ+ Sbjct: 450 FKTELYEEAVTGTEHFQHHEQD 471 >At2g13770.1 68415.m01521 hypothetical protein Length = 244 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 27 GILKI-FLIVRNTSLRWRQTLLHHVSCSCL 113 G+L++ F IV S W +T+LH + SC+ Sbjct: 170 GVLQLRFAIVAGPSRLWNKTVLHDIMTSCI 199 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,206,670 Number of Sequences: 28952 Number of extensions: 247352 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -