BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H08 (888 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 27 0.76 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 4.1 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 27.1 bits (57), Expect = 0.76 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 687 EVGPYVYREALEHKVXSFNSNGTLS 761 E+GPYVY + E N NGT+S Sbjct: 6 EMGPYVYVQTWEKVNIKGNPNGTIS 30 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.6 bits (51), Expect = 4.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 565 GAKSSRCGGNLKSSFIRGSFCST*LILXSTW 657 G +S+ G N ++S + SFCS L+ + W Sbjct: 165 GNQSTWIGANGRNSIVDVSFCSPSLVGDNNW 195 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 653,343 Number of Sequences: 2352 Number of extensions: 11745 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95507181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -