BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H07 (871 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 9.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.5 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 294 DESRNSIDENKEKDHDNASSASTVEVL 374 D +RN + +K K H + +AS + VL Sbjct: 223 DTARNFLTVSKIKKHIDGMAASKLNVL 249 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 9.5 Identities = 14/64 (21%), Positives = 25/64 (39%) Frame = +3 Query: 177 KCKSVKITQSXPVAEXXXNERXXTLKTDVSDVNSSKDAQDESRNSIDENKEKDHDNASSA 356 +C+S+K P + + KT D+ S QD ++ + +EK +A Sbjct: 81 QCRSIKNECPEPTCDEPVHRPGRCCKTCPGDLYDSDIIQDIVPQNVLDEEEKSSTKHYAA 140 Query: 357 STVE 368 E Sbjct: 141 LLTE 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,384 Number of Sequences: 336 Number of extensions: 2884 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23996456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -