BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H06 (878 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch... 27 2.7 SPBC660.07 |ntp1||alpha,alpha-trehalase Ntp1|Schizosaccharomyces... 26 6.1 >SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 476 Score = 27.5 bits (58), Expect = 2.7 Identities = 23/67 (34%), Positives = 31/67 (46%) Frame = +2 Query: 329 LAPRAPRTLFTIASPXEFRLIFAENNIKLMYKRHGLALTLGDSDINGRIAFGDSKDKTSP 508 + P P+T I E I E + L K+ GLAL D + RI DS T P Sbjct: 88 IKPDVPKTQSRIRQAYEGLSILNEAEVYLKNKQAGLALNALDR-LQRRI---DS--TTQP 141 Query: 509 RVSWMFI 529 +SWM++ Sbjct: 142 PMSWMYL 148 >SPBC660.07 |ntp1||alpha,alpha-trehalase Ntp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 735 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 485 DSKDKTSPRVSWMFIPLWENDKVYFKILNTKRNQYLTLGV 604 D+KD++ V+ +++P E + + + K YL L V Sbjct: 195 DTKDRSGSHVNRIYVPKAEQEMYEYYVRAAKERPYLNLQV 234 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,660,130 Number of Sequences: 5004 Number of extensions: 45988 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -