BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H06 (878 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75529-3|CAA99786.2| 1099|Caenorhabditis elegans Hypothetical pr... 29 5.8 AC024794-5|AAK68500.1| 320|Caenorhabditis elegans Hypothetical ... 28 7.7 >Z75529-3|CAA99786.2| 1099|Caenorhabditis elegans Hypothetical protein C44H9.4 protein. Length = 1099 Score = 28.7 bits (61), Expect = 5.8 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +2 Query: 548 KVYFKILNTKRNQYLTLGVNTNGHGGH 628 + YF++L+ + N+Y+ + + N HG H Sbjct: 156 RAYFRVLSAEDNKYILIACHANLHGLH 182 >AC024794-5|AAK68500.1| 320|Caenorhabditis elegans Hypothetical protein Y48G1BM.8 protein. Length = 320 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 407 IKLMYKRHGLALTLGDSD-INGRIAFGDSKDKTSPRVSWMFIPL 535 +KL+ RHG T DSD G S D+T P V+ +FI L Sbjct: 41 VKLLPYRHGSNTTSSDSDSFILNSGSGSSDDETPPPVAPIFISL 84 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,741,812 Number of Sequences: 27780 Number of extensions: 255237 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2213393798 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -