BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H06 (878 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 25 0.70 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 24 2.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 8.6 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 25.4 bits (53), Expect = 0.70 Identities = 17/71 (23%), Positives = 31/71 (43%) Frame = +2 Query: 287 TKQQDELHGVRLPALAPRAPRTLFTIASPXEFRLIFAENNIKLMYKRHGLALTLGDSDIN 466 T++ H + + + PRT F+ + FAEN +R L+ LG ++ Sbjct: 4 TRRVKRSHNGKNGSPEEKRPRTAFSAEQLARLKREFAENRYLTERRRQQLSRDLGLTEAQ 63 Query: 467 GRIAFGDSKDK 499 +I F + + K Sbjct: 64 IKIWFQNKRAK 74 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 23.8 bits (49), Expect = 2.1 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +2 Query: 338 RAPRTLFTIASPXEFRLIFAENNIKLMYKRHGLALTLGDSDINGRIAFGDSKDK 499 + PRT F+ + FAEN +R L+ LG ++ +I F + + K Sbjct: 21 KRPRTAFSGEQLARLKREFAENRYLTERRRQQLSRDLGLNEAQIKIWFQNKRAK 74 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 96 TGFIFGVTMXFVPENELKA*G 34 + F+FG F P EL A G Sbjct: 54 SAFLFGANALFTPGQELPARG 74 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,131 Number of Sequences: 438 Number of extensions: 3333 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -