BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H04 (892 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch... 27 3.6 SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyc... 26 6.3 SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit ... 26 6.3 >SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosaccharomyces pombe|chr 2|||Manual Length = 2358 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 688 WSRRWAAVAGGSRCCPWALLLGAPTLFWYXW 596 + R W + GGS PW +L A LF W Sbjct: 2164 YGRSWKYLWGGSLLAPWKMLTIAFFLFLSMW 2194 >SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -2 Query: 531 HGPAPAPARKAGSRFKCSSSLAXSYILSRLTCGTKYGG 418 HGP + A + L S + LT GT++GG Sbjct: 420 HGPCVSGAMNTIITTRAGKDLISSLVAGLLTIGTRFGG 457 >SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit Sec63 |Schizosaccharomyces pombe|chr 2|||Manual Length = 611 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 428 LVPQVKRDKIYXLAKLLEHLNR 493 LVP K K Y L L +HLNR Sbjct: 260 LVPNEKNPKEYILKLLFDHLNR 281 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,049,367 Number of Sequences: 5004 Number of extensions: 56195 Number of successful extensions: 139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -