BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H04 (892 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53149-6|AAZ82856.1| 284|Caenorhabditis elegans Hypothetical pr... 62 5e-10 Z68220-10|CAA92491.2| 1843|Caenorhabditis elegans Hypothetical p... 30 2.6 >U53149-6|AAZ82856.1| 284|Caenorhabditis elegans Hypothetical protein C24B5.4 protein. Length = 284 Score = 62.1 bits (144), Expect = 5e-10 Identities = 29/89 (32%), Positives = 47/89 (52%) Frame = +2 Query: 281 VLSNGLTTNFKFVEVSVADSPDLTEPPYYLKSPGLTGDAKLVEIGGPPYLVPQVKRDKIY 460 V L +NF+ VEV++ D PDL++PP+ KS G + ++ E+GGP L P D + Sbjct: 1 VFQTSLLSNFENVEVNIVDCPDLSKPPFNQKSSGFGHNLRIAEVGGPGNLYPGFHIDHQF 60 Query: 461 XLAKLLEHLNRXPAFLXXXXXXPWPYLGR 547 + K+ + A + PWP +G+ Sbjct: 61 DIPKIGKVCEHPEAAVFGPGAGPWPIVGQ 89 >Z68220-10|CAA92491.2| 1843|Caenorhabditis elegans Hypothetical protein T20D3.11 protein. Length = 1843 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 622 HPVGAPKGSSGYLQQQLPNDETRTALLGNYLLTEGNPEXYXSGRE 756 HP+ P+ ++Q + T +GN ++ +GNP +G E Sbjct: 1635 HPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGME 1679 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,655,586 Number of Sequences: 27780 Number of extensions: 348991 Number of successful extensions: 851 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2255353870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -