BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H03 (847 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 24 1.7 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 3.0 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 23 4.0 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 7.0 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 90 ALVLCGLLAAVSAAPQYY 143 A++LC L AVSAA Y Sbjct: 6 AVILCAFLVAVSAAENKY 23 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 Query: 451 NLPWDVNSEGSW 486 N WDV+S GSW Sbjct: 187 NAWWDVHSTGSW 198 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 14 PFXYREFLRFELVYF 58 PF Y++ + F+LVYF Sbjct: 155 PFDYKQPVVFDLVYF 169 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 84 MIALVLCGLLAAVSAAPQYYHGSSHWPYHHYD 179 MI L+ + AVSAAP ++ S Y H D Sbjct: 1 MIPLIAIAGILAVSAAPAEFYESR---YDHLD 29 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,330 Number of Sequences: 336 Number of extensions: 3098 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -