BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H03 (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa... 27 3.3 SPAC26A3.10 |||Arf GAP protein|Schizosaccharomyces pombe|chr 1||... 26 7.7 SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ... 26 7.7 >SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 27.1 bits (57), Expect = 3.3 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 127 PRHSTTMARHIGRITITT-PSVLTFGKACWTHI 222 P H+TT R I +I I PS+LT G +C HI Sbjct: 553 PVHATT--RFIAQIAILELPSILTTGYSCVMHI 583 >SPAC26A3.10 |||Arf GAP protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 923 Score = 25.8 bits (54), Expect = 7.7 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 207 MLDTHSLWSNLANEMQHLDDMMKELSLKFPSHYKRRTRGRRQVSDIYSP 353 +++ SLW AN + + +SLK S K R +GRR ++ +P Sbjct: 559 VVENGSLWE-YANWKDSVKSNVSSISLKHASADKVRKQGRRFCFEVVTP 606 >SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1877 Score = 25.8 bits (54), Expect = 7.7 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +3 Query: 249 MQHLDDMMKELSLKFPSHYKRRTRGRRQVSDIYSP 353 + HL ++M L+ FP+H++ + R ++ IY+P Sbjct: 355 LPHLIELMASLACVFPTHFQFAMKRLRLIA-IYAP 388 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,647,220 Number of Sequences: 5004 Number of extensions: 51576 Number of successful extensions: 130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -