BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_H02 (863 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 26 1.7 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 24 5.2 AJ419878-1|CAD12038.1| 77|Anopheles gambiae Sec61 protein prot... 23 9.1 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 25.8 bits (54), Expect = 1.7 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 468 SHVLSXVIPLILWITVLPPLSELIPLAA 385 S +LS V+ L+L +LPP S ++PL A Sbjct: 269 SILLSLVVFLLLVSKILPPTSLVLPLIA 296 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 24.2 bits (50), Expect = 5.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 651 QESARGSXPGGNAWYLYSP 595 +E AR S G NAW +Y P Sbjct: 595 EEHARISGDGYNAWAVYQP 613 >AJ419878-1|CAD12038.1| 77|Anopheles gambiae Sec61 protein protein. Length = 77 Score = 23.4 bits (48), Expect = 9.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 577 EVAKPDRTIKIPGVSPWXAPSCALLFRPCRLP 672 E+AKP+R I+ W A + + C++P Sbjct: 18 EIAKPERKIQFREKVLWTAITLFIFLVCCQIP 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,257 Number of Sequences: 2352 Number of extensions: 10988 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92199573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -