Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP04_F_G24
         (1445 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           27   1.0  

>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 27.5 bits (58), Expect = 1.0
 Identities = 18/69 (26%), Positives = 21/69 (30%), Gaps = 2/69 (2%)
 Frame = +2

Query: 248 PTXTXTXTXPTTAXDXXTQXXPRPXNXXK--XKEPNQPXQXXXQDXXPPXPNQTXAXXRR 421
           PT T T   PTT      Q  P P         +P            PP  N+  +    
Sbjct: 225 PTATTTTHAPTTTTTWSDQPPPPPTTTTTTVWTDPTTTITTDYTTAYPPTTNEPPSTPHP 284

Query: 422 XPPHNTXPG 448
             PH   PG
Sbjct: 285 TDPHCPPPG 293


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.303    0.120    0.371 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 608,692
Number of Sequences: 2352
Number of extensions: 6386
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 67
effective length of database: 406,395
effective search space used: 168247530
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 17 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (21.8 bits)