BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G22 (880 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22710.1 68417.m03276 cytochrome P450 family protein contains... 31 0.77 At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) fa... 29 3.1 At4g37320.1 68417.m05285 cytochrome P450 family protein 28 7.2 At5g37480.1 68418.m04514 expressed protein 28 9.5 >At4g22710.1 68417.m03276 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome p450 Length = 526 Score = 31.5 bits (68), Expect = 0.77 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -1 Query: 448 SKAMLLVPTINNVINYCFF---SVQERRMPSDPGHWPWLILRNVSLCSQL*LFMTHSFPN 278 S ML V + V+ Y + S ++ P PG WP I+ N+ + + T Sbjct: 23 SSVMLAVAALLAVVCYLWIQGKSKSKKEPPLPPGPWPLPIVGNLPFLNS-DVLHTQFQAL 81 Query: 277 DLGFSPVFPAQIGSRLALVQS 215 L + P+ +GS+LA+V S Sbjct: 82 TLKYGPLMKIHLGSKLAIVVS 102 >At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) family protein predicted proteins, Arabidopsis thaliana ; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 29.5 bits (63), Expect = 3.1 Identities = 31/108 (28%), Positives = 42/108 (38%), Gaps = 4/108 (3%) Frame = -1 Query: 508 AIKKFQ*KASLICQYYEY---NLSKAMLLVPTINNVINYCFFSVQERRMPSDPGHWPWLI 338 AIK F K + IC NL +L VPTIN + N + Q S +++ Sbjct: 234 AIKWFSTKGTRICDVCRQEVRNLPVILLRVPTINQLTNRRELTQQSSEPQSISVGQEFVV 293 Query: 337 LRNVSLCSQL*LFMTHSFPNDLGFSPVF-PAQIGSRLALVQSCMQAFL 197 L +S F+ H DL +F A LAL+ S L Sbjct: 294 LVLISTVCYF-FFLEHLLIRDLNSQAIFVAAPFSFTLALLASTFAVIL 340 >At4g37320.1 68417.m05285 cytochrome P450 family protein Length = 495 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = -1 Query: 391 SVQERRMPSDPGHWPWLILRNVSLCSQL*LFMTHSFPNDLGFSPVFPAQIGSRLALVQS 215 S ++ +P P + P ++ ++ L Q HS LG +P+F ++G+RL V S Sbjct: 25 SNRKPNLPPSPAY-PLPVIGHLHLLKQPVHRTFHSISKSLGNAPIFHLRLGNRLVYVIS 82 >At5g37480.1 68418.m04514 expressed protein Length = 156 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 249 AGKTGEKPKSFGNECVMNNYNCEHKDTLRKISQGQCPGSD 368 A K GE+P SFG+ + NY K L+ + PG++ Sbjct: 51 AAKEGEEPISFGDNASLLNYGLGWK--LKTVVDADLPGTE 88 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,518,009 Number of Sequences: 28952 Number of extensions: 247079 Number of successful extensions: 639 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2067932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -