BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G21 (869 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 27 0.15 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 9.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 9.5 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 27.5 bits (58), Expect = 0.15 Identities = 22/62 (35%), Positives = 28/62 (45%) Frame = -2 Query: 346 QFINSASHFINSIYDLIRHTLKFILHVL*K*LYVLCHFLHIFWIAGWC*VFIFCVFNNIV 167 +F +FI +IY L T LHV Y+ F HIF+ C FI + NIV Sbjct: 36 KFCRILKYFIIAIYVLTILTSSVTLHVCFN-SYMYA-FTHIFFFFAICCDFIALIVVNIV 93 Query: 166 RV 161 V Sbjct: 94 HV 95 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 409 FIYQFALEYHPKIIYAWINNKYK*FCRYLKLF 504 F++ + + KI + KY+ FCR LK F Sbjct: 16 FLFLLICDSYLKIYH---KEKYRKFCRILKYF 44 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 578 FVWGNCNFRFSEYLDFLIYVICCE 507 F+ NC EYL+F+ V+ E Sbjct: 358 FIMDNCEELIPEYLNFIKGVVDSE 381 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = -3 Query: 672 LLTLAYKYNIPMKTLK*FNLIYLFQILWM 586 ++ +AYK++ M L+ L+ F +W+ Sbjct: 471 MICVAYKFDAAMMALRTSFLVNDFGFIWL 499 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,865 Number of Sequences: 336 Number of extensions: 3875 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23996456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -