BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G20 (879 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 2.4 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 2.4 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 3.2 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 9.7 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.7 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 9.7 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.4 bits (48), Expect = 2.4 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = +2 Query: 485 NRSP--SQDFTRPIQMSLELSG 544 NR P +QD R ++MSLE SG Sbjct: 137 NRKPDDNQDHLRRLEMSLEKSG 158 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 671 EKDSGTNSLDPDTE 712 E DSG +S DPD E Sbjct: 134 ESDSGASSADPDDE 147 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = -2 Query: 401 IWKSDICWFFRPV---MFKFLKRITTPASFGAXTSNDVTTSGSIGH-MSYCG 258 IWK+ + W+ V + +FL+ + T AS + + +I H M + G Sbjct: 83 IWKTTVAWYAGNVACKVIRFLQVVVTYASTYVLVALSIDRYDAIRHPMKFSG 134 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.4 bits (43), Expect = 9.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 448 HIVGDIVIELTKQSKSFTGLYTADTNVIGA 537 H+V +I L + + F TA T VIGA Sbjct: 270 HLVEEIERSLREGAAPFMVSATAGTTVIGA 299 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 500 VKDFDCLVNSI 468 + DFDC +NSI Sbjct: 372 ISDFDCDINSI 382 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +2 Query: 188 ANLVTCNALAVRXSSFWRKPVKGYHNTTYG 277 + ++ ++ + +SF+R GY+ TT+G Sbjct: 234 SKIIISGSIFMTTTSFYRILNSGYNLTTFG 263 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,319 Number of Sequences: 336 Number of extensions: 3087 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24306755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -