BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G20 (879 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.02 |||ClC chloride channel|Schizosaccharomyces pombe|chr... 26 6.1 SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharo... 26 8.1 >SPBC887.02 |||ClC chloride channel|Schizosaccharomyces pombe|chr 2|||Manual Length = 667 Score = 26.2 bits (55), Expect = 6.1 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = -2 Query: 488 DCLVNSITMSPTICKSAFVFSSTVLALVSIWKSDICWFFRPVMFKFLKRITTPASFGA 315 + L N + + P + S SSTVL + W + I F + L + T A+FGA Sbjct: 351 ELLFNPMELFPQVINSCSPSSSTVLCETTFWVTAIVLFTSAL----LGLLLTSATFGA 404 >SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +1 Query: 457 GDIVIELTKQSKSFTGLYTADTNVIGAVRYGYNLKND 567 G IVI L +S L+ D I + YG + D Sbjct: 139 GSIVINLRDSGESLPPLFFHDDECISTIEYGKQITRD 175 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,814,662 Number of Sequences: 5004 Number of extensions: 53612 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -