Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP04_F_G20
         (879 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY187042-1|AAO39756.1|  248|Anopheles gambiae putative antennal ...    48   5e-07

>AY187042-1|AAO39756.1|  248|Anopheles gambiae putative antennal
           carrier protein TOL-2 protein.
          Length = 248

 Score = 47.6 bits (108), Expect = 5e-07
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +1

Query: 187 CKLGDMQCLSSATXQFLEKTSKGIPQYDIWPIDPLVVTSLDVF-APNDAGVVIRFKNLNI 363
           CK GD  C+  A     +K   G+P   +  +DPL +  +D+        +V+ FKN++I
Sbjct: 29  CKTGDEPCVVQAITNTFQKFQGGVPALGLASLDPLRIDEMDIVQGTGPVNIVLNFKNVDI 88

Query: 364 TGLKN 378
           TG K+
Sbjct: 89  TGFKD 93


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 712,453
Number of Sequences: 2352
Number of extensions: 12863
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 94266828
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)