BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G20 (879 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41991-1|AAA83341.2| 1400|Caenorhabditis elegans Rna polymerase,... 29 4.4 Z82274-9|CAB05232.2| 260|Caenorhabditis elegans Hypothetical pr... 28 7.7 >U41991-1|AAA83341.2| 1400|Caenorhabditis elegans Rna polymerase, class iii (c) protein1 protein. Length = 1400 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -2 Query: 452 ICKSAFVFSSTVLALVSIWKSDICWFFRPVMFKFLKRITTP-ASFGAXTSNDV 297 ICK+ + +++LA + K+ +C F +K + IT P + GA + + Sbjct: 1002 ICKNLEAYKTSLLANSCLTKTQLCSFIELCYYKVARAITEPGTAVGAIAATSI 1054 >Z82274-9|CAB05232.2| 260|Caenorhabditis elegans Hypothetical protein JC8.5 protein. Length = 260 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 519 IGRVKSCEGLRLFSQLDYDVPNNM*IGFRLQQHRL 415 I +K CE + Q + DVP++M F+ QQH + Sbjct: 105 IANMKKCEDRLIRVQFNSDVPSSMRWEFKPQQHEI 139 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,643,434 Number of Sequences: 27780 Number of extensions: 302414 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2213393798 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -