BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G17 (908 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(... 29 4.6 U97196-1|AAK68667.2| 3279|Caenorhabditis elegans Hypothetical pr... 28 8.0 >AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 51 protein. Length = 354 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +3 Query: 492 ATGSGVWDLDKNTRLSAGGMVSKEFGHRRPDVGVQAEFRHDW*SRRSHQDIIDLNNNLLP 671 A G+G+ +L K+ + + F DV V ++ R +W + + +DL +N P Sbjct: 2 AHGNGIAELYKSVMADVIANMKEAFLDENIDVDVLSQLRKEWEDKVNSSGCVDLESNAPP 61 >U97196-1|AAK68667.2| 3279|Caenorhabditis elegans Hypothetical protein B0207.5 protein. Length = 3279 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 214 DTRVTSPGTNKWGEGRSSARWAKMMMGFLVKP 309 +TR + GTNK +GR+ R M +G ++KP Sbjct: 3195 ETRTRNKGTNKRRDGRNDGR--NMNLGSIIKP 3224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,480,851 Number of Sequences: 27780 Number of extensions: 390474 Number of successful extensions: 908 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2318293978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -