BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G16 (874 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 24 1.4 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 24 1.8 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 9.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.6 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 24.2 bits (50), Expect = 1.4 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 332 VAKHVELARVQTLVDFIFHARSIVRHCRVVRMRFSC 225 V K E +++Q LVD I H S C + SC Sbjct: 111 VTKTSETSKLQQLVDNIEHKLSDPNQCVICHRVLSC 146 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 377 PWRFRCRNSEKRYPW 421 P RFR NS+KR+P+ Sbjct: 126 PERFRPENSQKRHPF 140 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 436 PTXHHPRITFFAISTPKPPRP 374 P PR T + P+PPRP Sbjct: 250 PPTPKPRPTKVSRRKPRPPRP 270 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 9.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 297 SRRFHLPRALHCSPLPSCSNALLLYLVSAFS 205 SR H P P+P S+ + YLVS +S Sbjct: 65 SRADHSPVFGKVEPVPHTSSFNMGYLVSPYS 95 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,878 Number of Sequences: 336 Number of extensions: 3675 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24099889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -