BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G15 (878 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 25 0.70 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 4.9 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 8.6 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 25.4 bits (53), Expect = 0.70 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 112 LTWLT*VKANVVSSLYICYH*KWRKSSVRFLVYC 213 +TWL + + + +Y C+ +R++ VR L C Sbjct: 375 VTWLGWINSGMNPVIYACWSRDFRRAFVRILCAC 408 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 712 SYVSHLVVVSAFLTLLLPPLRSVFDILISNIAFPFVL 822 S + LVV ++ +LPP V ++ + F F++ Sbjct: 270 SILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIM 306 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 723 PLGGGVSFPYFTPSSTS 773 P+G G SFP P +T+ Sbjct: 385 PIGSGGSFPSLYPMATT 401 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,357 Number of Sequences: 438 Number of extensions: 4627 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -