BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G15 (878 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46540.1 68418.m05730 ABC transporter family protein contains... 30 1.8 At3g17740.1 68416.m02264 expressed protein 29 4.1 >At5g46540.1 68418.m05730 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1248 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +3 Query: 228 IMGDIIEITTWPKHRHIFYKVNSSSINFEVKADNAAVGLAKEAGMKCDYWVVLGDR 395 +MG +I + + H H+F +V+ ++ F A A G+ + C W+V G+R Sbjct: 55 LMGQLINVFGFSDHDHVFKEVSKVAVKFLYLA--AYAGVVSFLQVSC--WMVTGER 106 >At3g17740.1 68416.m02264 expressed protein Length = 1149 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 447 IISNSEYRQFSISWSKNGVCLGQNGELEPIMKLECKEQN 563 + S+ R F WS NG +G+ G ++ LE +E+N Sbjct: 472 LTEQSKLRLFEHFWSSNGARVGEEGAFGWLLWLEKEEEN 510 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,441,276 Number of Sequences: 28952 Number of extensions: 297813 Number of successful extensions: 620 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2067932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -