BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G11 (895 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) seve... 161 4e-40 At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) 158 4e-39 At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) 158 4e-39 At3g04710.1 68416.m00505 ankyrin repeat family protein contains ... 29 3.1 At3g14440.1 68416.m01830 9-cis-epoxycarotenoid dioxygenase, puta... 29 5.5 >At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) several 40S ribosomal protein S26 Length = 130 Score = 161 bits (392), Expect = 4e-40 Identities = 72/113 (63%), Positives = 86/113 (76%) Frame = +2 Query: 92 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 271 MT KRRNGGR KH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 272 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKXDRRIRTPPKSNFPRDMSRPQAVQ 430 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPAQ 113 >At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) Length = 131 Score = 158 bits (384), Expect = 4e-39 Identities = 71/113 (62%), Positives = 85/113 (75%) Frame = +2 Query: 92 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 271 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 272 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKXDRRIRTPPKSNFPRDMSRPQAVQ 430 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQ 113 >At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) Length = 133 Score = 158 bits (384), Expect = 4e-39 Identities = 71/113 (62%), Positives = 85/113 (75%) Frame = +2 Query: 92 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 271 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 272 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKXDRRIRTPPKSNFPRDMSRPQAVQ 430 + LPKLYAK YCVSCAIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQ 113 >At3g04710.1 68416.m00505 ankyrin repeat family protein contains Pfam profile: PF00023 ankyrin repeat Length = 456 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 47 FFPAVLCSPGS-EVRNMTRKRRNGGRAKHGRGHVKA 151 F+ VL SP S E+ + R+ + GR HG+G VKA Sbjct: 419 FYEGVLLSPESKELIDAFREAVDAGRKFHGKGEVKA 454 >At3g14440.1 68416.m01830 9-cis-epoxycarotenoid dioxygenase, putative / neoxanthin cleavage enzyme, putative / carotenoid cleavage dioxygenase, putative similar to 9-cis-epoxycarotenoid dioxygenase GB:AAF26356 [GI:6715257][Phaseolus vulgaris] Length = 599 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 302 LHYCVSCAIHSKVVRNRSKXDRRIRTPPKSNFPRDMSRPQAV 427 L YC S + S+V R + + TPP +FP+ S A+ Sbjct: 32 LSYCSSLPMASRVTR-KLNVSSALHTPPALHFPKQSSNSPAI 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,404,649 Number of Sequences: 28952 Number of extensions: 206080 Number of successful extensions: 443 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -