BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G09 (864 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 4.8 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 4.8 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 4.8 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 4.8 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 4.8 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 6.3 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 6.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 6.3 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 8.4 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 8.4 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 8.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 8.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 8.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 8.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 8.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 8.4 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 8.4 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 8.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 8.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 8.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 8.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 8.4 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 8.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 8.4 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV VP C Sbjct: 110 LQYYNINYIEQIPIPVPVPIYC 131 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV VP C Sbjct: 110 LQYYNINYIEQIPIPVPVPIYC 131 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV VP C Sbjct: 110 LQYYNINYIEQIPIPVPVPIYC 131 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV VP C Sbjct: 110 LQYYNINYIEQIPIPVPVPIYC 131 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.6 bits (46), Expect = 4.8 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 628 SYYEGLSSFVSDLSLG---LYNNTYIVYXXLPVKVPANC 735 +Y +S++ +D + YN YI +PV VP C Sbjct: 88 NYISNISNYNNDNNYNKKLYYNINYIEQIPVPVPVPIYC 126 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 110 YNINYIEQIPVPVPVPVYC 128 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPIPVPVPIYC 129 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 328 YNINYIEQIPIPVPVPIYC 346 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 108 YNINYIEQIPVPVPVPIYC 126 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPVPVPVPIYC 129 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPVPVPVPIYC 129 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPVPVPVPIYC 129 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPVPVPVPIYC 129 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPVPVPVPIYC 129 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPVPVPVPIYC 129 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 111 YNINYIEQIPVPVPVPIYC 129 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 114 YNINYIEQIPVPVPVPIYC 132 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 119 YNINYIEQIPVPVPVPIYC 137 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV +P C Sbjct: 321 LQYYNINYIEQIPVPVPIPIYC 342 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV +P C Sbjct: 332 LQYYNINYIEQIPVPVPIPIYC 353 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV +P C Sbjct: 332 LQYYNINYIEQIPVPVPIPIYC 353 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 670 LGLYNNTYIVYXXLPVKVPANC 735 L YN YI +PV +P C Sbjct: 321 LQYYNINYIEQIPVPVPIPIYC 342 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 346 YNINYIEQIPVPVPVPIYC 364 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 679 YNNTYIVYXXLPVKVPANC 735 YN YI +PV VP C Sbjct: 353 YNINYIEQIPVPVPVPIYC 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,123 Number of Sequences: 438 Number of extensions: 2525 Number of successful extensions: 27 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -