BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G08 (918 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 28 2.1 SPAC2E1P3.05c |||fungal cellulose binding domain protein|Schizos... 26 8.6 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 27.9 bits (59), Expect = 2.1 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -2 Query: 404 SIYHCDRSFSNISNTIHSISFVNA 333 S++ +FSNI++ IH ISF NA Sbjct: 800 SLFRWSATFSNIADGIHRISFNNA 823 >SPAC2E1P3.05c |||fungal cellulose binding domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 197 Score = 25.8 bits (54), Expect = 8.6 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = -2 Query: 461 STTQGKTKIHKFTLTSYDLSIYHCDRSFSNISNTIHSISFVNAFFSSVS 315 STT + + TLTS S S +IS+TI S S + F+S+S Sbjct: 123 STTSSSSLVSSTTLTSSSPSAVSSTTSIPSISSTISS-SVSTSSFTSLS 170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,748,472 Number of Sequences: 5004 Number of extensions: 29086 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -