BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G08 (918 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28720.1 68416.m03586 expressed protein 30 2.5 >At3g28720.1 68416.m03586 expressed protein Length = 687 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = -2 Query: 428 FTLTSYDLSIYHCDRSFSNISNTI-HSISFVNAFFSSVSRN*KHRWLXLAILMALRPLPT 252 F Y L + SF+++S+++ S+S + FSS+S++ L ++I + +R + Sbjct: 40 FLTNQYRLDPKSSNDSFTSLSSSLKRSLSSSSIHFSSLSKSLLS--LSISIPLNVRFIGD 97 Query: 251 AFPTVLMALIGIFAGAAVLHD 189 +FP+ + + F AAV +D Sbjct: 98 SFPSSAASTLSEFISAAVTND 118 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,804,589 Number of Sequences: 28952 Number of extensions: 139812 Number of successful extensions: 240 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -