BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G04 (873 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 1.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.4 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 5.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 9.6 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 9.6 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 9.6 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 9.6 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 9.6 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 24.6 bits (51), Expect = 1.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 435 WNKLTXPATPSCSPKPGMRVPVRLSPCP 352 W P+ + SP+P +PV P P Sbjct: 67 WQVTPLPSDGTTSPEPDPEIPVAPEPAP 94 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 502 TRPTSTRWAAEWTT 543 TRPT+T W + TT Sbjct: 1072 TRPTTTNWPTQGTT 1085 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 812 NPYVRIXKGXYDFTAFA*YF*KNFEKENPTLG 717 N Y+ G DF A + ++ K+N TLG Sbjct: 154 NTYILALDGDIDFQPEALHLLVDYMKKNKTLG 185 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 812 NPYVRIXKGXYDFTAFA*YF*KNFEKENPTLG 717 N Y+ G DF A + ++ K+N TLG Sbjct: 468 NTYILALDGDIDFQPEALHLLVDYMKKNKTLG 499 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 812 NPYVRIXKGXYDFTAFA*YF*KNFEKENPTLG 717 N Y+ G DF A + ++ K+N TLG Sbjct: 701 NTYILALDGDIDFQPEALHLLVDYMKKNKTLG 732 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 812 NPYVRIXKGXYDFTAFA*YF*KNFEKENPTLG 717 N Y+ G DF A + ++ K+N TLG Sbjct: 701 NTYILALDGDIDFQPEALHLLVDYMKKNKTLG 732 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 323 EAALSLWRSLKSADPMALSTF 261 E L+ W+ KSA+ +A+ F Sbjct: 372 EVNLTCWQDTKSANKIAMKLF 392 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 480 NSPSAIPNAPNFNTLGGG 533 N+PSA N NFN G Sbjct: 130 NTPSATNNNTNFNNNSNG 147 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 9.6 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 778 ILLLSHNTFRRISRRRI 728 ILLL +TFR IS R I Sbjct: 358 ILLLVSSTFRTISGRTI 374 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 480 NSPSAIPNAPNFNTLGGG 533 N+PSA N NFN G Sbjct: 78 NTPSATNNNTNFNNNSNG 95 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 480 NSPSAIPNAPNFNTLGGG 533 N+PSA N NFN G Sbjct: 261 NTPSATNNNTNFNNNSNG 278 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,889 Number of Sequences: 336 Number of extensions: 2692 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24099889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -