BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G02 (878 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40600| Best HMM Match : DUF667 (HMM E-Value=0.35) 29 6.6 SB_56697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_43817| Best HMM Match : WD40 (HMM E-Value=1e-13) 28 8.7 >SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 262 GNCLKGLVDLNVLKNEIEE 318 GNCLKG+V++NV N IE+ Sbjct: 277 GNCLKGIVNVNVSPNIIEQ 295 >SB_40600| Best HMM Match : DUF667 (HMM E-Value=0.35) Length = 449 Score = 28.7 bits (61), Expect = 6.6 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = -1 Query: 365 SQYFL-KTSSSAPFGLASSISF---FRTFKSTSPLRQFPKVRNAASTXRDFVFS 216 ++YF+ S GLA +SF F+ FKSTS QFP V N + + V S Sbjct: 379 TKYFVVHLDVSTEDGLAVRVSFSNLFKEFKSTSTWLQFPFVSNPSPNSVEAVTS 432 >SB_56697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 496 YKDGDRIALFIAEGGPECFQQKTENLKTCFLNLKQSFPTVESANNLS 636 Y G +I F+A+ +C + TENL+ N + T E+A LS Sbjct: 46 YLHGFKIESFVAQNPFDCSIKCTENLRCQSFNYQSESSTSENACELS 92 >SB_43817| Best HMM Match : WD40 (HMM E-Value=1e-13) Length = 822 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -1 Query: 326 GLASSISF---FRTFKSTSPLRQFPKVRNAASTXRDFVFS 216 GLA +SF F+ FKSTS QFP V N + + V S Sbjct: 61 GLAVRVSFSNLFKEFKSTSTWLQFPFVSNPSPNSVEAVTS 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,199,367 Number of Sequences: 59808 Number of extensions: 401348 Number of successful extensions: 961 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2502612210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -