BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_G01 (850 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 4.7 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 4.7 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 8.2 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 433 LVDDQISLSGPHGIIGRAVVLHEKADDYGKSDHPDSRK 546 ++D+ I LSG G V+LH + + D++K Sbjct: 401 ILDEPIELSGYRLTAGTVVLLHTWIAGLNEENFKDAKK 438 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 322 SHFNPEHKDHGHPNDVNRHV 381 S F+ + KD G PND N ++ Sbjct: 345 SSFDFQSKDQGPPNDGNGNI 364 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 600 LQISXLLVLFNTIYIFF 650 +QI L VLFNT++I + Sbjct: 4 MQILTLGVLFNTLHIIY 20 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,005 Number of Sequences: 438 Number of extensions: 2206 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -